DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14407 and Glrx5

DIOPT Version :9

Sequence 1:NP_572974.1 Gene:CG14407 / 32410 FlyBaseID:FBgn0030584 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_082695.1 Gene:Glrx5 / 73046 MGIID:1920296 Length:152 Species:Mus musculus


Alignment Length:126 Identity:78/126 - (61%)
Similarity:103/126 - (81%) Gaps:6/126 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 AATGAAVDKATMDKLVRTNKVVVFMKGNPQAPRCGFSNAVVQIMRMHGVQ-YDAHDVLQNESLRQ 96
            |::|...::  :|.||:.:|||||:||.|:.|:||||||||||:|:|||: |.|::||.:..|||
Mouse    32 ASSGGQAEQ--LDALVKKDKVVVFLKGTPEQPQCGFSNAVVQILRLHGVRDYAAYNVLDDPELRQ 94

  Fly    97 GVKDYTDWPTIPQVFINGEFVGGCDILLQMHQSGDLIEELKKAGIISELLKAEEAKQQDDK 157
            |:|||::|||||||::||||||||||||||||:|||:|||||.||.|.|:   :.|.||.|
Mouse    95 GIKDYSNWPTIPQVYLNGEFVGGCDILLQMHQNGDLVEELKKLGIRSALV---DEKDQDSK 152

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG14407NP_572974.1 GRX_PICOT_like 44..132 CDD:239326 61/88 (69%)
Glrx5NP_082695.1 GRX_PICOT_like 41..131 CDD:239326 62/89 (70%)
Glutathione binding. /evidence=ECO:0000250|UniProtKB:Q86SX6 93..97 3/3 (100%)