DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14407 and Glrx3

DIOPT Version :9

Sequence 1:NP_572974.1 Gene:CG14407 / 32410 FlyBaseID:FBgn0030584 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_116003.2 Gene:Glrx3 / 58815 RGDID:69414 Length:337 Species:Rattus norvegicus


Alignment Length:104 Identity:43/104 - (41%)
Similarity:68/104 - (65%) Gaps:0/104 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 MDKLVRTNKVVVFMKGNPQAPRCGFSNAVVQIMRMHGVQYDAHDVLQNESLRQGVKDYTDWPTIP 108
            :.||......::||||.||.||||||..:|:|:..|.:|:.:.|:..:|.:|||:|.|::|||.|
  Rat   139 LKKLTHAAPCMLFMKGTPQEPRCGFSKQMVEILHKHNIQFSSFDIFSDEEVRQGLKTYSNWPTYP 203

  Fly   109 QVFINGEFVGGCDILLQMHQSGDLIEELKKAGIISELLK 147
            |::::||.:||.||:.::..|.:|.....||..:.|.||
  Rat   204 QLYVSGELIGGLDIIKELEASEELDTICPKAPKLEERLK 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14407NP_572974.1 GRX_PICOT_like 44..132 CDD:239326 37/87 (43%)
Glrx3NP_116003.2 TRX_PICOT 20..115 CDD:239282
GRX_PICOT_like 139..227 CDD:239326 37/87 (43%)
GRX_PICOT_like 241..329 CDD:239326 2/2 (100%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0278
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1449534at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.