DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14407 and GLRX5

DIOPT Version :9

Sequence 1:NP_572974.1 Gene:CG14407 / 32410 FlyBaseID:FBgn0030584 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_057501.2 Gene:GLRX5 / 51218 HGNCID:20134 Length:157 Species:Homo sapiens


Alignment Length:129 Identity:81/129 - (62%)
Similarity:102/129 - (79%) Gaps:3/129 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 AADAATGAAVDKATMDKLVRTNKVVVFMKGNPQAPRCGFSNAVVQIMRMHGVQ-YDAHDVLQNES 93
            ||.:..|.......:|.||:.:|||||:||.|:.|:||||||||||:|:|||: |.|::||.:..
Human    31 AAGSGAGGGGSAEQLDALVKKDKVVVFLKGTPEQPQCGFSNAVVQILRLHGVRDYAAYNVLDDPE 95

  Fly    94 LRQGVKDYTDWPTIPQVFINGEFVGGCDILLQMHQSGDLIEELKKAGIISELLKAEEAKQQDDK 157
            ||||:|||::|||||||::||||||||||||||||:|||:|||||.||.|.||  :|.|.||.|
Human    96 LRQGIKDYSNWPTIPQVYLNGEFVGGCDILLQMHQNGDLVEELKKLGIHSALL--DEKKDQDSK 157

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG14407NP_572974.1 GRX_PICOT_like 44..132 CDD:239326 61/88 (69%)
GLRX5NP_057501.2 GRX_PICOT_like 45..135 CDD:239326 62/89 (70%)
Glutathione binding. /evidence=ECO:0000269|PubMed:21029046 97..101 3/3 (100%)