DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14407 and glrx5

DIOPT Version :9

Sequence 1:NP_572974.1 Gene:CG14407 / 32410 FlyBaseID:FBgn0030584 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_998186.1 Gene:glrx5 / 406294 ZFINID:ZDB-GENE-040426-1957 Length:155 Species:Danio rerio


Alignment Length:115 Identity:71/115 - (61%)
Similarity:94/115 - (81%) Gaps:1/115 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 AAVDKATMDKLVRTNKVVVFMKGNPQAPRCGFSNAVVQIMRMHGV-QYDAHDVLQNESLRQGVKD 100
            ::..:..::::|:.:||||||||.|..|.||||||||||:||||| .|.:::||.::.:|||:|.
Zfish    38 SSAGQKNLEEMVKKDKVVVFMKGTPAQPMCGFSNAVVQILRMHGVDNYASYNVLDDQDVRQGIKT 102

  Fly   101 YTDWPTIPQVFINGEFVGGCDILLQMHQSGDLIEELKKAGIISELLKAEE 150
            :::||||||||.||||||||||||||||||||:|||:|.||.|.||..|:
Zfish   103 FSNWPTIPQVFFNGEFVGGCDILLQMHQSGDLVEELQKLGIRSALLDQEK 152

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG14407NP_572974.1 GRX_PICOT_like 44..132 CDD:239326 59/88 (67%)
glrx5NP_998186.1 GRX_PICOT_like 45..135 CDD:239326 60/89 (67%)
Glutathione binding. /evidence=ECO:0000250|UniProtKB:Q86SX6 97..101 3/3 (100%)