DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14407 and Glrx5

DIOPT Version :9

Sequence 1:NP_572974.1 Gene:CG14407 / 32410 FlyBaseID:FBgn0030584 Length:159 Species:Drosophila melanogaster
Sequence 2:XP_006240544.1 Gene:Glrx5 / 362776 RGDID:1308383 Length:233 Species:Rattus norvegicus


Alignment Length:145 Identity:78/145 - (53%)
Similarity:104/145 - (71%) Gaps:25/145 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 AATGAAVDKATMDKLVRTNKVVVFMKGNPQAPRCGFSNAVVQIMRMHGVQ-YDAHDVLQNESLRQ 96
            |::|...::  :|.||:.:|||||:||.|:.|:||||||||||:|:|||: |.|::||::..|||
  Rat    94 ASSGGQAEQ--LDALVKKDKVVVFLKGTPEQPQCGFSNAVVQILRLHGVRDYAAYNVLEDPELRQ 156

  Fly    97 G-------------------VKDYTDWPTIPQVFINGEFVGGCDILLQMHQSGDLIEELKKAGII 142
            |                   :|||::|||||||::||||||||||||||||:|||:|||||.||.
  Rat   157 GQARGTWRRGRGELEQISRSIKDYSNWPTIPQVYLNGEFVGGCDILLQMHQNGDLVEELKKLGIR 221

  Fly   143 SELLKAEEAKQQDDK 157
            |.|:   :.|.||.|
  Rat   222 SALI---DEKDQDSK 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14407NP_572974.1 GRX_PICOT_like 44..132 CDD:239326 61/107 (57%)
Glrx5XP_006240544.1 GRX_PICOT_like 103..212 CDD:239326 62/108 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166353983
Domainoid 1 1.000 103 1.000 Domainoid score I6648
eggNOG 1 0.900 - - E1_COG0278
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H31984
Inparanoid 1 1.050 161 1.000 Inparanoid score I4140
OMA 1 1.010 - - QHG61708
OrthoDB 1 1.010 - - D1449534at2759
OrthoFinder 1 1.000 - - FOG0003200
OrthoInspector 1 1.000 - - oto97208
orthoMCL 1 0.900 - - OOG6_101462
Panther 1 1.100 - - LDO PTHR10293
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2152
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.770

Return to query results.
Submit another query.