DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14407 and Glrx3

DIOPT Version :9

Sequence 1:NP_572974.1 Gene:CG14407 / 32410 FlyBaseID:FBgn0030584 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_075629.2 Gene:Glrx3 / 30926 MGIID:1353653 Length:337 Species:Mus musculus


Alignment Length:138 Identity:49/138 - (35%)
Similarity:79/138 - (57%) Gaps:12/138 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 APQSLLTRFLAADAATGAAVDKAT----------MDKLVRTNKVVVFMKGNPQAPRCGFSNAVVQ 74
            ||:  ||:.:....::||......          :.||......::||||.||.||||||..:|:
Mouse   107 APE--LTKKVQRHVSSGAFPPSTNEHLKEDLSLRLKKLTHAAPCMLFMKGTPQEPRCGFSKQMVE 169

  Fly    75 IMRMHGVQYDAHDVLQNESLRQGVKDYTDWPTIPQVFINGEFVGGCDILLQMHQSGDLIEELKKA 139
            |:..|.:|:.:.|:..:|.:|||:|.|::|||.||::::||.:||.||:.::..|.:|.....||
Mouse   170 ILHKHNIQFSSFDIFSDEEVRQGLKTYSNWPTYPQLYVSGELIGGLDIIKELEASEELDTICPKA 234

  Fly   140 GIISELLK 147
            ..:.|.||
Mouse   235 PKLEERLK 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14407NP_572974.1 GRX_PICOT_like 44..132 CDD:239326 37/87 (43%)
Glrx3NP_075629.2 TRX_PICOT 20..115 CDD:239282 4/9 (44%)
GRX_PICOT_like 139..227 CDD:239326 37/87 (43%)
GRX_PICOT_like 241..329 CDD:239326 2/2 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0278
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.