DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14407 and grx5

DIOPT Version :9

Sequence 1:NP_572974.1 Gene:CG14407 / 32410 FlyBaseID:FBgn0030584 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_593888.1 Gene:grx5 / 2543483 PomBaseID:SPAPB2B4.02 Length:146 Species:Schizosaccharomyces pombe


Alignment Length:149 Identity:57/149 - (38%)
Similarity:90/149 - (60%) Gaps:16/149 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 RYQILATTAPQSLLTRFLAADAATGAAVDKATMDKLVRTNKVVVFMKGNPQAPRCGFSNAVVQIM 76
            |:.|..|:.  |:..|.|:...       :..:::.|:.:.:|:||||.|..|.||||...:||:
pombe     6 RFWIPKTSI--SMQLRMLSTQT-------RQALEQAVKEDPIVLFMKGTPTRPMCGFSLKAIQIL 61

  Fly    77 RMHGVQYD---AHDVLQNESLRQGVKDYTDWPTIPQVFINGEFVGGCDILLQMHQSGDLIEELKK 138
            .:..|..|   .::||.|:.||:|:|:::|||||||::||||||||.|||..||:||:|.:.||:
pombe    62 SLENVASDKLVTYNVLSNDELREGIKEFSDWPTIPQLYINGEFVGGSDILASMHKSGELHKILKE 126

  Fly   139 AGIISELLKAEEAKQQDDK 157
            .    ..|..|:.|..:::
pombe   127 I----NALAPEQPKDSEEE 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14407NP_572974.1 GRX_PICOT_like 44..132 CDD:239326 45/90 (50%)
grx5NP_593888.1 GrxD 22..128 CDD:223355 48/116 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 82 1.000 Domainoid score I2291
eggNOG 1 0.900 - - E1_COG0278
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H31984
Inparanoid 1 1.050 109 1.000 Inparanoid score I1584
OMA 1 1.010 - - QHG61708
OrthoFinder 1 1.000 - - FOG0003200
OrthoInspector 1 1.000 - - oto101305
orthoMCL 1 0.900 - - OOG6_101462
Panther 1 1.100 - - LDO PTHR10293
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R498
SonicParanoid 1 1.000 - - X2152
TreeFam 1 0.960 - -
1413.860

Return to query results.
Submit another query.