DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14407 and glrx-3

DIOPT Version :9

Sequence 1:NP_572974.1 Gene:CG14407 / 32410 FlyBaseID:FBgn0030584 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_001023756.1 Gene:glrx-3 / 178828 WormBaseID:WBGene00017062 Length:345 Species:Caenorhabditis elegans


Alignment Length:139 Identity:50/139 - (35%)
Similarity:83/139 - (59%) Gaps:6/139 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 QSLRHPRYQILATTAPQSLLTRFLAADAATGAAVDKATMDKLVRTNKVVVFMKGNPQAPRCGFSN 70
            :||........:||:....||.....:|.      .|.:..||.:.||:|||||:|.|||||||.
 Worm   107 RSLSQSSSDASSTTSSTPSLTPQQEKEAL------NARLGALVNSQKVMVFMKGDPSAPRCGFSR 165

  Fly    71 AVVQIMRMHGVQYDAHDVLQNESLRQGVKDYTDWPTIPQVFINGEFVGGCDILLQMHQSGDLIEE 135
            .:|:::..|.:::.:.|:..:|::|||:|:|::|||.||::.:||.:||.|::.:.......|::
 Worm   166 TIVELLNSHKIKFGSFDIFSDEAVRQGLKEYSNWPTYPQLYFDGELIGGLDVVKEEFSDPQFIKQ 230

  Fly   136 LKKAGIISE 144
            |.|.|..||
 Worm   231 LPKVGENSE 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14407NP_572974.1 GRX_PICOT_like 44..132 CDD:239326 36/87 (41%)
glrx-3NP_001023756.1 TRX_PICOT 8..101 CDD:239282
GRX_PICOT_like 139..227 CDD:239326 36/87 (41%)
GRX_PICOT_like 247..328 CDD:239326
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1449534at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.