DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14411 and XB5960519

DIOPT Version :9

Sequence 1:NP_001162756.1 Gene:CG14411 / 32408 FlyBaseID:FBgn0030582 Length:843 Species:Drosophila melanogaster
Sequence 2:XP_031751608.1 Gene:XB5960519 / 100216114 XenbaseID:XB-GENE-5960520 Length:563 Species:Xenopus tropicalis


Alignment Length:513 Identity:126/513 - (24%)
Similarity:201/513 - (39%) Gaps:120/513 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   167 ITELGRAASALQAARGMASHAGMSRRKKLEPFKQQNISGRIAALHIVCKNFRLLKFAFQQQDSKM 231
            |.||.....|:........:.|  |.:..|..::.::......:.:.||:.|::.......:..:
 Frog    52 IAELWLLHCAVDKVEKSVQNIG--RLQNTENGQEMDVESGSGTVTLRCKDLRVIHMEIPGMEETL 114

  Fly   232 FGASDQGKLIASALVRFAYPMRHDLSFAYAHREPYYSTLGASGTSMYATKNDWAREL-------I 289
            ..|.....|.:..:|..:||        :..|.|.|| ||          :.|.|:.       :
 Frog   115 NIARSVQALSSLDIVTLSYP--------FFFRPPGYS-LG----------HGWPRDTMENFYHKM 160

  Fly   290 RCGATEWQVVS-------CASVQLLQNPLQAGKYTVPPHFVIPKSCSVDRFLDLSRAFCDSRAAF 347
            |....:|::..       |.|              .|...::|:.|| |..|..:.||..: ..|
 Frog   161 RAETDDWRLSEVNLDFKICPS--------------YPAKVIVPRICS-DETLQKAAAFRQA-GRF 209

  Fly   348 WVYSYGSSA---ALVRLAE-LQPAAQQDTKSENVMLEL------------VRKCDAGRQLK---- 392
            .|.||..||   ||:|.|: |...|....|.:..:|..            .|.....:|.:    
 Frog   210 PVLSYYHSANQTALLRSAQPLFGTAPHHCKHDEALLNAALMEQSSGFIIDTRSAQEAKQARNEGG 274

  Fly   393 -------------LLQLTDRLPSIQDVLRAYQKLRRLCTPETPEKFMLQDDKYLGLLEKTNWLFY 444
                         |.:..:|..::||.|     :|.:.|...|...|   .::|..|:...||.:
 Frog   275 GTESKSRYRNWRVLHRPLERGHALQDSL-----VRLVVTCYDPSIGM---TRWLSKLQAARWLSH 331

  Fly   445 VSLCLRYASEASATLRSGVTCVLQE--------SNGRDLCCVISSLAQLLLDPHFRTIDGFQSLV 501
            |       .||.:|......|:.:|        .:|.|...:::|||||:|.|..||:||||.|:
 Frog   332 V-------KEALSTAGLIAECIERECANVLVHGEDGTDNTLLLTSLAQLILCPESRTMDGFQDLI 389

  Fly   502 QKEWVALEHPFQRRLGHVYPAQPAGGNAELFDSEQSPVFLLFLDCVWQLLQQFPDEFEFTQTYLT 566
            ::||:...||||.|...       .|.::....::||.|||||||.|||.:|||...||.:.:|.
 Frog   390 EREWLQAGHPFQLRCAQ-------SGWSQSRAQQESPHFLLFLDCCWQLGRQFPRALEFNERFLC 447

  Fly   567 TLWDSCFMPIFDTFQFDTQAQRLK-AVTDSQLVLRPVWDWGEQFSDKDKMFFSNPLYQ 623
            ||....:...:.:|..:.:.:|.: .|.|....|     ||.....|::....||:||
 Frog   448 TLATHAYSSEYGSFLCNNEKERCQYEVQDRTHSL-----WGHLNQPKERQQLLNPIYQ 500

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14411NP_001162756.1 PH-like <114..225 CDD:302622 10/57 (18%)
PTPc <400..587 CDD:304379 62/194 (32%)
3-PAP <666..732 CDD:289355
XB5960519XP_031751608.1 PH-GRAM_MTMR9 1..121 CDD:275398 11/70 (16%)
Myotub-related 147..470 CDD:399535 94/360 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.