DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14408 and sh3bp5b

DIOPT Version :9

Sequence 1:NP_001285247.1 Gene:CG14408 / 32407 FlyBaseID:FBgn0030581 Length:684 Species:Drosophila melanogaster
Sequence 2:NP_998623.1 Gene:sh3bp5b / 406767 ZFINID:ZDB-GENE-040426-2813 Length:446 Species:Danio rerio


Alignment Length:464 Identity:121/464 - (26%)
Similarity:207/464 - (44%) Gaps:92/464 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VDPRVQVELEKLNSATDNINRYEVELDEAKCEFKRLLAESVVRIKAAAHKLGNSIDAAKPYYESR 73
            ||||:|.||||||.:||:|||.|.||::|:.:|:.:|.|:.:::.....|:|.:::.:|||:|:|
Zfish    22 VDPRIQGELEKLNQSTDDINRCETELEDARQKFRSVLVEATLKLDELVKKIGKAVEESKPYWEAR 86

  Fly    74 IYAAQLAKETQLAAANHEKAKSIHAAAKEMVYLAEQGL--GEKSTLDTACQEMLSHAASKVNQSQ 136
            ..|.|...|.|.:..:.::|..:..||||.:.||||.|  .:|...|:|.:|||:||..:|.:: 
Zfish    87 RVARQTQLEAQRSTQDFQRATEVLRAAKETIALAEQRLLEDDKRQFDSAWREMLNHATQRVMEA- 150

  Fly   137 LEVTDTRNAL--KMCQLKLEVANNRVGKLQGQLKQALRASRLQLKRNLLLLRYFSIMHALYCTLC 199
             |...||:.|  |........|.:|:.:.:.:||:.:..|:                        
Zfish   151 -EQIKTRSELLHKETAANYTAAMSRMKQQEKKLKRTINKSK------------------------ 190

  Fly   200 SPYYETRANYNGLLKAQKTRVNELEAKVSAAKLTYNEALKNLEQISEDIHRQRQQ-----RNNLL 259
             ||:|.:|.|...|:..|..|::|:||::.||..|..||:.||.||::||.:|:.     |...:
Zfish   191 -PYFEMKAKYYLQLEQLKKNVDDLQAKLTQAKGEYKSALRKLEMISDEIHERRRSLGIGPRERGV 254

  Fly   260 NYE----------AMLRQVDAVDTLTAGLERSSCGTAA-NRQDLEAKAAAEEQKHVEAEAEEEEE 313
            ..|          ....:.|.:...:...|..:|.|:| :.:|.|.::.:.......:..:    
Zfish   255 GAEGDGVIGEDLSGFKMESDGISMASGSYEDENCSTSAMSEEDSETQSNSSFSSGPNSPVD---- 315

  Fly   314 EYLRMPERLGHHECPHLLTDFEAVLTFPQKLAGGMHKSASTGAAADGEAGLGPLGLHAPYEVKSG 378
                :|       ||                    ..|:|:.::........|..|..|..|...
Zfish   316 ----LP-------CP--------------------FSSSSSSSSTSPTPSSRPCSLDLPSTVSLS 349

  Fly   379 SGSLASGSASVSTSAGGAPA-DNDIEQWTEIRLSHSDSTSSSYSNQSLLEQQ----GLDSTGGMS 438
            ..||.|......:...||.: :.|:|:..  |...:::...:..|.:.:...    ||||...: 
Zfish   350 DFSLMSPILGPRSECSGASSPECDLERGD--RAEGAEAVLDNVLNNNSISNAKTTFGLDSRFRL- 411

  Fly   439 GGLGLGLAR 447
              |.|.|:|
Zfish   412 --LSLKLSR 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14408NP_001285247.1 SH3BP5 7..255 CDD:283045 86/254 (34%)
sh3bp5bNP_998623.1 SH3BP5 22..244 CDD:283045 86/248 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D258813at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19423
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.