DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rut and CG34357

DIOPT Version :9

Sequence 1:NP_511156.2 Gene:rut / 32406 FlyBaseID:FBgn0003301 Length:2248 Species:Drosophila melanogaster
Sequence 2:NP_001356914.1 Gene:CG34357 / 5740349 FlyBaseID:FBgn0085386 Length:1689 Species:Drosophila melanogaster


Alignment Length:626 Identity:146/626 - (23%)
Similarity:229/626 - (36%) Gaps:199/626 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   206 MMERAQRRTFLDT------------RNCIASRLEIQD-ENEKLERLLLSVLPQHVAMQMKNDI-L 256
            |:...::..|:||            ...|..|.|..| |.:|.|:||..:||..||.::|..: :
  Fly  1037 MLNHGRKVNFVDTMFQMLEKYSNNLEELIRERTEQLDIERKKTEQLLNRMLPSSVAEKLKMGLAV 1101

  Fly   257 SPVAGQFHRIYIQKHENVSILFADIVGFTVLSSQCSAQELVRLLNELFGRFDQLAHDNHCLRIKI 321
            .|          ::..:|:|.|:||||||.:::.||..::|.|||:|:..||...:..:..:::.
  Fly  1102 DP----------EEFSDVTIYFSDIVGFTTIAAHCSPVQVVDLLNDLYTIFDATINAYNVYKVET 1156

  Fly   322 LGDCYYCVSGLPEPRKDHAKCAVEMGLDMIDAIA--TVVEATDVILNMRVGIHTGRVLCGVLGLR 384
            :||.|..|||||....|||:....|.||::....  .|.....|.|.:|:|:|||....||:||.
  Fly  1157 IGDAYMVVSGLPVKIPDHAEQIATMALDLLHQSGRFNVKHLPGVPLQLRIGLHTGPCCAGVVGLT 1221

  Fly   385 KWQFDVWSNDVTLANHMESGGEPGRVHVTRATLDSLS--GEYEVE-------AGHGDERSSY-LR 439
            ..::.::.:.|..|:.|||.|...|:|:::.|.|.|.  |.|.:|       .|.|...:.: |.
  Fly  1222 MPRYCLFGDTVNTASRMESTGSSWRIHMSQETRDRLDARGGYAIEPRGLIDIKGKGMMNTFWLLG 1286

  Fly   440 DHGVDTFFIVPPPHRR-----KPLMLNTLGVRS-------------------------------- 467
            ..|.|.....|||...     :.|:.|::.:::                                
  Fly  1287 KKGFDKPLPAPPPIGESHGLDESLIRNSITLKAQANKSRTSTNPSSSQSSSLAGESVEVKVEITP 1351

  Fly   468 ------AIGSRRKLSFRNVSNVVMQLLHTI------------------------KFSEPVPFSNI 502
                  |.|:....|:...||..    :||                        |.||..|.:.:
  Fly  1352 PTNADLASGTNLPNSYSLDSNST----NTISPNATLCPEFPGKTTPSSTSPQSRKLSELTPENLL 1412

  Fly   503 ATGSFPSAASALGGGV-----------------------------------------SVGGGGGG 526
            ...||....|:.||..                                         ||.||.||
  Fly  1413 NPNSFNRLPSSTGGSSSRLYKKIEEMMDLSSPYNHYKCLSPSESNLTQFYDGKYLYGSVAGGAGG 1477

  Fly   527 G--GGGVA-----RGSTCEANSGNVQVSEKGSRKVIRLQKIL------------HATPPPHGMGY 572
            |  |||..     .||.|...:.... |:.||.:::|.|..|            |.........|
  Fly  1478 GQAGGGACASIALSGSGCGGGASRFD-SKPGSSRLLRRQFSLDRDDQQAKGEQQHHQHSLQANTY 1541

  Fly   573 GSVVGSGGGVDSGISGGGGCVSGGIAGGGGVQVTVGTNP------NSTASTISRIHRHNHKN-NK 630
            ..:|             |||       ||||:.::...|      .|...|::|.|:.|..: .:
  Fly  1542 SGLV-------------GGC-------GGGVKSSMLDIPLLHDTTRSPKGTLTRSHKQNSASITQ 1586

  Fly   631 SQSKVADKFKRPFRKRHSVAAHHQPTNRVNRFLSQAINARS 671
            ...|:.:....|...:|    |....:.:||.....:.|:|
  Fly  1587 DLEKIEEIPLSPASSQH----HSSLDSNLNRSPPSTLEAQS 1623

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rutNP_511156.2 AC_N <17..255 CDD:292831 18/61 (30%)
CYCc 230..425 CDD:214485 68/200 (34%)
Guanylate_cyc 266..438 CDD:278633 60/183 (33%)
DUF1053 624..696 CDD:283888 9/49 (18%)
SLC5-6-like_sbd <742..>893 CDD:294310
CYCc 924..1134 CDD:214485
Guanylate_cyc 954..1151 CDD:278633
CG34357NP_001356914.1 PKc_like 763..1041 CDD:354810 1/3 (33%)
CYCc 1074..1266 CDD:214485 68/201 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.