DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rut and gucy1b2

DIOPT Version :9

Sequence 1:NP_511156.2 Gene:rut / 32406 FlyBaseID:FBgn0003301 Length:2248 Species:Drosophila melanogaster
Sequence 2:XP_685297.5 Gene:gucy1b2 / 557191 ZFINID:ZDB-GENE-130530-664 Length:757 Species:Danio rerio


Alignment Length:422 Identity:106/422 - (25%)
Similarity:188/422 - (44%) Gaps:82/422 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   877 LHLISLARIAIFMIAILVHGRLVEGTARLDFLWQLQASQEK-----KEMDVLQESNKRILHNLLP 936
            |||..:|:.......||::.:.:   |.::...||:..:|:     :.:::.::.::::|:.:||
Zfish   385 LHLADIAQHDTTRDLILLNQQRL---AEIELSNQLERKKEELRILSRNLEIEKQKSEKLLYAMLP 446

  Fly   937 AHVAAHFLDAQFRNNMELYHQSYAKVGVIFASVPNFNEFYTEMDGSDQGLECLRLLNEIIADFDE 1001
            .|||     .|.:....:....:....::|:.|..|    |.:..:.:.::.:.:||.:.:.||.
Zfish   447 THVA-----NQLKEGKRVEAGEFKVCTILFSDVVTF----TNICAACEPIQIVNMLNAMYSRFDR 502

  Fly  1002 LLKEDRFRGIDKIKTVGSTYMAVVGLIPEYKIQPNDPNSVRRHMTALIEYVKAMRHSLQEI-NSH 1065
            |..   ...:.|::|:|..||.|.|:          |.....|...:..:...||.:.:|: |..
Zfish   503 LTS---IHNVYKVETIGDAYMVVGGV----------PVPTNTHAERVANFALGMRIAAREVTNPI 554

  Fly  1066 SYNNFMLRVGINIGPVVAGVIGARKPQYDIWGNTVNVASRMDSTGVPGYSQVT----QEVVDSLV 1126
            :.....:|||::.|||:|||:|.:.|:|.::|:|||.||||:|.|||.:..|:    ..:.|..:
Zfish   555 TGQPIQIRVGLHTGPVLAGVVGEKMPRYCLFGDTVNTASRMESHGVPDHIHVSPFTFSVIKDKGI 619

  Fly  1127 GSHFEFRCRGTIKVKGKGDMVTYFLCDSGNKS---LNGEVRNAMSLPQS--LHAPDYYMKVSQFP 1186
               ||...||.|:|||||.|.||||..:..||   :.|.|...|.:.|.  ....|...:||  |
Zfish   620 ---FEMAERGEIEVKGKGLMRTYFLLKNLQKSDEQIMGLVDGEMCVYQEDLEEETDDLKEVS--P 679

  Fly  1187 EN-----RVNTDTYSK-KENGHLYAGNGVEEQQLLLQHQHKQHDPLPLPAPPPPVHHHLHQQQQQ 1245
            |:     :|..|.:.: .|||:.:.                        :||.|...|..:....
Zfish   680 EDMNAVLKVEEDAHKEVAENGNNHT------------------------SPPSPSSLHSDKSSSD 720

  Fly  1246 RLNSKLQKQPIFMANGGLPNIRENGNGHNGEH 1277
            .| .:....|.:.:.....::      |||.|
Zfish   721 HL-IQFDITPAYDSPNDFKHL------HNGHH 745

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rutNP_511156.2 AC_N <17..255 CDD:292831
CYCc 230..425 CDD:214485
Guanylate_cyc 266..438 CDD:278633
DUF1053 624..696 CDD:283888
SLC5-6-like_sbd <742..>893 CDD:294310 4/15 (27%)
CYCc 924..1134 CDD:214485 57/214 (27%)
Guanylate_cyc 954..1151 CDD:278633 61/201 (30%)
gucy1b2XP_685297.5 HNOB 2..163 CDD:285002
CAF-1_p150 <166..277 CDD:288454
HNOBA 269..453 CDD:285003 16/75 (21%)
CYCc 432..618 CDD:214485 55/207 (27%)
Guanylate_cyc 459..642 CDD:278633 62/202 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.