DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rut and npr1b

DIOPT Version :9

Sequence 1:NP_511156.2 Gene:rut / 32406 FlyBaseID:FBgn0003301 Length:2248 Species:Drosophila melanogaster
Sequence 2:XP_009290669.2 Gene:npr1b / 555911 ZFINID:ZDB-GENE-100805-4 Length:1070 Species:Danio rerio


Alignment Length:259 Identity:82/259 - (31%)
Similarity:131/259 - (50%) Gaps:42/259 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   209 RAQRRTFLDTRNCIASRLE----------------IQDENEKLERLLLSVLPQHVAMQMKNDILS 257
            |..|...||.   :.||:|                ..:|..|.|.||..:||..||.|:|..   
Zfish   817 REHRSNILDN---LLSRMEQYANNLEELVEERTQAYLEEKRKAEALLYQILPHSVAEQLKRG--- 875

  Fly   258 PVAGQFHRIYIQKHENVSILFADIVGFTVLSSQCSAQELVRLLNELFGRFDQLAHDNHCLRIKIL 322
                  ..:..:..::|:|.|:||||||.||::.:..::|.|||:|:..||.:..:....:::.:
Zfish   876 ------ETVQAEAFDSVTIYFSDIVGFTSLSAESTPLQVVTLLNDLYTCFDAIIDNFDVYKVETI 934

  Fly   323 GDCYYCVSGLP-EPRKDHAKCAVEMGLDMIDAIAT--VVEATDVILNMRVGIHTGRVLCGVLGLR 384
            ||.|..||||| ...|.|.:....|.|.:::|:.|  :....|..|.:|:|||:|.|..||:||:
Zfish   935 GDAYMVVSGLPVRNGKLHGREIARMSLALLEAVKTFKIRHRPDEQLKLRIGIHSGPVCAGVVGLK 999

  Fly   385 KWQFDVWSNDVTLANHMESGGEPGRVHV---TRATLD-------SLSGEYEVEAGHGDERSSYL 438
            ..::.::.:.|..::.|||.|||.::||   |||.|.       .|.|:.|:: |.|..|:.:|
Zfish  1000 MPRYCLFGDTVNTSSRMESNGEPLKIHVSSATRAVLQEFNCFQLELRGDVEMK-GKGKMRTYWL 1062

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rutNP_511156.2 AC_N <17..255 CDD:292831 18/61 (30%)
CYCc 230..425 CDD:214485 70/207 (34%)
Guanylate_cyc 266..438 CDD:278633 63/184 (34%)
DUF1053 624..696 CDD:283888
SLC5-6-like_sbd <742..>893 CDD:294310
CYCc 924..1134 CDD:214485
Guanylate_cyc 954..1151 CDD:278633
npr1bXP_009290669.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.