DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rut and Gucy1a1

DIOPT Version :9

Sequence 1:NP_511156.2 Gene:rut / 32406 FlyBaseID:FBgn0003301 Length:2248 Species:Drosophila melanogaster
Sequence 2:NP_058786.2 Gene:Gucy1a1 / 497757 RGDID:68436 Length:690 Species:Rattus norvegicus


Alignment Length:232 Identity:72/232 - (31%)
Similarity:119/232 - (51%) Gaps:27/232 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   191 VIFIGVNVAGLVVNIMMERAQRRTFLDTR-NCIASRLE-----IQDENEKLERLLLSVLPQHVAM 249
            |:.||            |:|:.:..|..| ..:.:.||     :::|.:|...||.|:.|..||.
  Rat   411 VVLIG------------EQARAQDGLKKRLGKLKATLEHAHQALEEEKKKTVDLLCSIFPSEVAQ 463

  Fly   250 QMKNDILSPVAGQFHRIYIQKHENVSILFADIVGFTVLSSQCSAQELVRLLNELFGRFDQLAHDN 314
            |:..       ||.  :..:|...|::||:||||||.:.||||..:::.:||.|:.||||...:.
  Rat   464 QLWQ-------GQI--VQAKKFNEVTMLFSDIVGFTAICSQCSPLQVITMLNALYTRFDQQCGEL 519

  Fly   315 HCLRIKILGDCYYCVSGLPEPRKDHAKCAVEMGLDMIDAIATVVEATDVILNMRVGIHTGRVLCG 379
            ...:::.:||.|....||......||.....|.|.|::....|:......:.||:|:|:|.|..|
  Rat   520 DVYKVETIGDAYCVAGGLHRESDTHAVQIALMALKMMELSNEVMSPHGEPIKMRIGLHSGSVFAG 584

  Fly   380 VLGLRKWQFDVWSNDVTLANHMESGGEPGRVHVTRAT 416
            |:|::..::.::.|:|||||..||...|.:::|:..|
  Rat   585 VVGVKMPRYCLFGNNVTLANKFESCSVPRKINVSPTT 621

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rutNP_511156.2 AC_N <17..255 CDD:292831 18/69 (26%)
CYCc 230..425 CDD:214485 63/187 (34%)
Guanylate_cyc 266..438 CDD:278633 52/151 (34%)
DUF1053 624..696 CDD:283888
SLC5-6-like_sbd <742..>893 CDD:294310
CYCc 924..1134 CDD:214485
Guanylate_cyc 954..1151 CDD:278633
Gucy1a1NP_058786.2 HNOB <111..234 CDD:285002
HNOBA 276..465 CDD:285003 17/65 (26%)
CYCc 444..633 CDD:214485 63/187 (34%)
Guanylate_cyc 471..642 CDD:278633 52/151 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.