DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rut and Gycbeta100B

DIOPT Version :9

Sequence 1:NP_511156.2 Gene:rut / 32406 FlyBaseID:FBgn0003301 Length:2248 Species:Drosophila melanogaster
Sequence 2:NP_524603.2 Gene:Gycbeta100B / 43682 FlyBaseID:FBgn0013973 Length:787 Species:Drosophila melanogaster


Alignment Length:424 Identity:112/424 - (26%)
Similarity:174/424 - (41%) Gaps:152/424 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   206 MMERAQRRTFLDTRNCIASRLEIQDENEKLERLLLSVLPQHVAMQMKNDILSPVAGQFHRIYIQK 270
            |:....::||.|          ::.|.:|.:|||.||||:.||.::::.  .||..       ::
  Fly   481 MLTDKLQQTFRD----------LESEKQKTDRLLYSVLPKSVANELRHQ--RPVPP-------KR 526

  Fly   271 HENVSILFADIVGFTVLSSQCS-------AQELVRLLNELFGRFDQLAHDNHCL---RIKILGDC 325
            :::|:::|:.||||   ...|:       |.::|::||||:..||.|......|   :::.:||.
  Fly   527 YDSVTLMFSGIVGF---GQYCAANTDPDGAMKIVKMLNELYTVFDALTDSKRNLNVYKVETVGDK 588

  Fly   326 YYCVSGLPEPRKDHAKCAVEMGLDMIDAIATVVEATDVILNMRVGIHTGRVLCGVLGLRKWQFDV 390
            |..|||||:..:|||||...:.|||:|....|...::.: .:.:|||:|.|:.||:|.|..::.:
  Fly   589 YMAVSGLPDHCEDHAKCMARVALDMMDMAKNVKMGSNPV-QITIGIHSGEVVTGVIGNRVPRYCL 652

  Fly   391 WSNDVTLANHMESGGEPGRVHVTRATL----------DSLSGEYEVEAGHGDERSSYLRDHGVDT 445
            :.|.|.|.:..|:.|.|||::|:..|.          ||...||                     
  Fly   653 FGNTVNLTSRTETTGVPGRINVSEETYRLLCMAINQDDSFHLEY--------------------- 696

  Fly   446 FFIVPPPHRRKPLMLNTLGVRSAIGSRRKLSFRNVSNVVMQLLHTIKFSEPVP----FSNIATGS 506
                     |.|:::.                                .:|.|    |...||  
  Fly   697 ---------RGPVIMK--------------------------------GKPTPMDCWFLTRAT-- 718

  Fly   507 FPSAASALGGGVSVGGGGGGGGGG----VARGSTCEANSGNVQVSEKGSRKVIRLQKILHATPPP 567
                :|.|||..|.||.||||.|.    :.:.:|..|.:                     |||.|
  Fly   719 ----SSILGGTSSTGGSGGGGNGSLDSPLLQPATPTAGA---------------------ATPIP 758

  Fly   568 ----HGMGYGSV--VGSGGGVDSGISGGGGCVSG 595
                ...|:.||  ..|.||      ||||.|.|
  Fly   759 VVAQRAAGHASVSRTSSAGG------GGGGAVVG 786

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rutNP_511156.2 AC_N <17..255 CDD:292831 15/48 (31%)
CYCc 230..425 CDD:214485 70/214 (33%)
Guanylate_cyc 266..438 CDD:278633 58/191 (30%)
DUF1053 624..696 CDD:283888
SLC5-6-like_sbd <742..>893 CDD:294310
CYCc 924..1134 CDD:214485
Guanylate_cyc 954..1151 CDD:278633
Gycbeta100BNP_524603.2 HNOB 2..164 CDD:285002
HNOBA 326..516 CDD:285003 15/44 (34%)
CYCc 496..688 CDD:214485 67/204 (33%)
Guanylate_cyc 522..714 CDD:278633 63/264 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.