DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rut and CG33958

DIOPT Version :9

Sequence 1:NP_511156.2 Gene:rut / 32406 FlyBaseID:FBgn0003301 Length:2248 Species:Drosophila melanogaster
Sequence 2:NP_001033958.1 Gene:CG33958 / 37088 FlyBaseID:FBgn0053958 Length:710 Species:Drosophila melanogaster


Alignment Length:466 Identity:124/466 - (26%)
Similarity:197/466 - (42%) Gaps:103/466 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   761 DISESFSLR--------------------MAITIFTVILIYSVGQVNVFTCVSD----HPCSGNG 801
            :|:.||.:|                    ||..:....|.|:....|::|.::.    |.....|
  Fly   294 NIATSFGIRYYGRGSLTAENFVSYVRYEFMAREMINSTLNYAPMLKNMYTNITSTKKFHRAKQMG 358

  Fly   802 TTSFQND---SHRKCSLPQYVSLSAAFAFLSVSVFLRLPIIFKSLLVLGMGTIYGLFIELSHQNI 863
            ||..:|:   |:.:.::..|..::      :.:..||  |:.|:|..|                |
  Fly   359 TTLLKNNPNVSNERSAIEYYELMN------NYTDDLR--ILQKALRRL----------------I 399

  Fly   864 FECYDNRVNASIPLHLISLARIAIFMIAILVHGRLVEGTARLDFLWQLQASQEKKEMDVLQESNK 928
            .|..|..:..:.....|.:|.:.:.:|...|...||:..|....|:.|..||:.||:...:..:.
  Fly   400 KEYVDKTLVEADRKEAIGIAILVVVLIVSPVIIVLVKNAAATIQLYALNLSQKAKELKREKRKSD 464

  Fly   929 RILHNLLPAHVAAHFLDAQFRNNMELYHQSYAKVGVIFASVPNFNEFYTEMDGSDQGLECLRLLN 993
            .:|..:||..||     .|.:...::..:.|..|.:.|:.:..|    ||:......||.:..||
  Fly   465 SLLFQMLPPSVA-----MQLKQTQQVPAELYEAVTIYFSDIVGF----TEIAADCTPLEVVTFLN 520

  Fly   994 EIIADFDELLKEDRFRGIDKIKTVGSTYMAVVGL-----------IPEYKIQPNDPNSVRRHMTA 1047
            .|...|||.::   ...:.|::|:|.:||...||           |....:...|.:||.|...|
  Fly   521 SIYRVFDERIE---CYDVYKVETIGDSYMVASGLPVKNGNKHISEIATMALDLLDASSVFRIPRA 582

  Fly  1048 LIEYVKAMRHSLQEINSHSYNNFMLRVGINIGPVVAGVIGARKPQYDIWGNTVNVASRMDSTGVP 1112
            ..|:|:                  :|.|::.||||||::|.:.|:|.::|:|||.||||:|||..
  Fly   583 GDEFVQ------------------IRCGVHTGPVVAGIVGTKMPRYCLFGDTVNTASRMESTGEA 629

  Fly  1113 GYSQVTQEVVDSL--VGSHFEFRCRGTIKVKGKGDMVTYFL-CDSG------NKSLNGEVRNAMS 1168
            ....:|:|:.|||  ||. |....||.|.|||||.|.||:| |..|      ..|...:::....
  Fly   630 QKIHITEEMHDSLQQVGG-FRTEHRGLIDVKGKGLMSTYWLTCKDGPVRAREEISWRADIQPVFL 693

  Fly  1169 LPQSLHAP-DY 1178
            ....||.| ||
  Fly   694 DHLKLHPPTDY 704

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rutNP_511156.2 AC_N <17..255 CDD:292831
CYCc 230..425 CDD:214485
Guanylate_cyc 266..438 CDD:278633
DUF1053 624..696 CDD:283888
SLC5-6-like_sbd <742..>893 CDD:294310 29/158 (18%)
CYCc 924..1134 CDD:214485 65/222 (29%)
Guanylate_cyc 954..1151 CDD:278633 70/209 (33%)
CG33958NP_001033958.1 NIT 159..396 CDD:285564 21/109 (19%)
HNOBA <439..479 CDD:285003 12/44 (27%)
CYCc 459..647 CDD:214485 63/217 (29%)
Guanylate_cyc 485..669 CDD:278633 70/209 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.