DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rut and Phlpp

DIOPT Version :9

Sequence 1:NP_511156.2 Gene:rut / 32406 FlyBaseID:FBgn0003301 Length:2248 Species:Drosophila melanogaster
Sequence 2:NP_001260558.1 Gene:Phlpp / 35178 FlyBaseID:FBgn0032749 Length:954 Species:Drosophila melanogaster


Alignment Length:453 Identity:84/453 - (18%)
Similarity:141/453 - (31%) Gaps:156/453 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly  1822 QQQNMDHEHLAGGKLLGSNSFMIAKHPVGLEAIKEITRNKNPSESSQMQTSDTESCEILHENRNQ 1886
            |:.::....|.|..|:|:.:::..         .|:..|    |...:..|.....|.|..:||:
  Fly    49 QKLSLKGSQLGGSILIGNYNYLTQ---------LEVCEN----EMEVLDLSSLAQLETLKCSRNK 100

  Fly  1887 MHVLAMLEMHTAKELNGSHA------HHGQHHQQPQRTHRQRPRSKELQYSHESLDGLD---GAV 1942
            :..|.         :||::.      |:..|:.....||....:.:.:..||.:...|.   ||.
  Fly   101 LMELI---------INGTNLQTLVADHNYLHNISTTNTHPVPLKLQRIDISHNNFSELPNWVGAC 156

  Fly  1943 QSQS--QQRHQRYHH-------------------HHHHQQRQQQQQRYNHVQEQEERDDTEDNLA 1986
            .|.:  ...|.|.::                   ::..:|..|..:.::.::..:.:.:...:|.
  Fly   157 ASLTAINASHNRLNNVAVLLRNYRITELVSLDLAYNDLKQLDQFPEGFSSIRSLQLQSNELPSLP 221

  Fly  1987 DEEFEDDEVGRDVRQKRLQKSELNHKRSEVAT----EAGNHHDDEVEEEDDDDDEEEDHRNGGRE 2047
            |..|.       |...||:  .||...::::|    |..||                        
  Fly   222 DNFFA-------VTHARLE--TLNVSCNKLSTLPRYEQNNH------------------------ 253

  Fly  2048 AAPLTNGSMRGLEANVINDEL--------KYGATHLNHQSMDSNPLESQSEWSDDDCREEATGGA 2104
             |.|.|.|:.|   |.:||.:        |....||.:..:...|......|             
  Fly   254 -AALVNLSLAG---NHLNDSIFEPLHNAAKLRVLHLAYNRIGVLPAACVRNW------------- 301

  Fly  2105 ESTGYITDEPGLENISLLNEAGLTDAEGALSDVNSLYNAPDVDDTSVSSRASSRLL--------- 2160
                     |.||.:.|..              |.|...|:    .|::....|:|         
  Fly   302 ---------PELEILVLSG--------------NMLQQLPE----EVATLGQLRVLRCCNNLLLC 339

  Fly  2161 --SLDSLSGLYDCDLDSKHELAIVNASHKISS---KFGQPLSPAQQQHQQQQQQQQQQQQQHH 2218
              .|..|:.|...||...| |..||....:.|   |:.......|.|..:||.:..|.|.|.|
  Fly   340 TPQLAKLAMLKVLDLSHNH-LDRVNLLALVPSRNLKYLDLSGNLQLQVDEQQFKVCQSQSQRH 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rutNP_511156.2 AC_N <17..255 CDD:292831
CYCc 230..425 CDD:214485
Guanylate_cyc 266..438 CDD:278633
DUF1053 624..696 CDD:283888
SLC5-6-like_sbd <742..>893 CDD:294310
CYCc 924..1134 CDD:214485
Guanylate_cyc 954..1151 CDD:278633
PhlppNP_001260558.1 leucine-rich repeat 91..110 CDD:275380 7/27 (26%)
LRR_8 109..169 CDD:290566 11/59 (19%)
leucine-rich repeat 111..135 CDD:275380 4/23 (17%)
leucine-rich repeat 136..158 CDD:275380 5/21 (24%)
leucine-rich repeat 159..183 CDD:275380 2/23 (9%)
leucine-rich repeat 184..209 CDD:275380 2/24 (8%)
LRR_8 205..266 CDD:290566 18/97 (19%)
leucine-rich repeat 210..230 CDD:275380 4/26 (15%)
leucine-rich repeat 232..255 CDD:275380 7/49 (14%)
LRR_RI <256..410 CDD:238064 41/190 (22%)
leucine-rich repeat 256..276 CDD:275380 7/22 (32%)
LRR_8 279..359 CDD:290566 21/120 (18%)
leucine-rich repeat 280..303 CDD:275380 4/44 (9%)
leucine-rich repeat 304..348 CDD:275380 11/61 (18%)
leucine-rich repeat 349..372 CDD:275380 8/23 (35%)
PP2Cc 461..655 CDD:294085
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.