DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rut and GUCY1B1

DIOPT Version :9

Sequence 1:NP_511156.2 Gene:rut / 32406 FlyBaseID:FBgn0003301 Length:2248 Species:Drosophila melanogaster
Sequence 2:XP_011530203.1 Gene:GUCY1B1 / 2983 HGNCID:4687 Length:662 Species:Homo sapiens


Alignment Length:189 Identity:69/189 - (36%)
Similarity:109/189 - (57%) Gaps:17/189 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   235 LERLLLSVLPQHVAMQMKNDILSPVAGQFHRIYIQKHENVSILFADIVGFTVLSSQCS----AQE 295
            |.|||.||||..||.::::.  .||..       ::::||:|||:.||||....|:.:    |.:
Human   433 LNRLLYSVLPPSVANELRHK--RPVPA-------KRYDNVTILFSGIVGFNAFCSKHASGEGAMK 488

  Fly   296 LVRLLNELFGRFDQLAHDN---HCLRIKILGDCYYCVSGLPEPRKDHAKCAVEMGLDMIDAIATV 357
            :|.|||:|:.|||.|....   ...:::.:||.|..|||||||...||:....:.|||:: ||..
Human   489 IVNLLNDLYTRFDTLTDSRKNPFVYKVETVGDKYMTVSGLPEPCIHHARSICHLALDMME-IAGQ 552

  Fly   358 VEATDVILNMRVGIHTGRVLCGVLGLRKWQFDVWSNDVTLANHMESGGEPGRVHVTRAT 416
            |:.....:.:.:|||||.|:.||:|.|..::.::.|.|.|.:..|:.||.|:::|:..|
Human   553 VQVDGESVQITIGIHTGEVVTGVIGQRMPRYCLFGNTVNLTSRTETTGEKGKINVSEYT 611

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rutNP_511156.2 AC_N <17..255 CDD:292831 10/19 (53%)
CYCc 230..425 CDD:214485 69/189 (37%)
Guanylate_cyc 266..438 CDD:278633 57/158 (36%)
DUF1053 624..696 CDD:283888
SLC5-6-like_sbd <742..>893 CDD:294310
CYCc 924..1134 CDD:214485
Guanylate_cyc 954..1151 CDD:278633
GUCY1B1XP_011530203.1 HNOB 2..166 CDD:311572
HNOBA 207..449 CDD:311573 10/15 (67%)
Guanylate_cyc 455..648 CDD:306677 58/165 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.