DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rut and Gucy2c

DIOPT Version :9

Sequence 1:NP_511156.2 Gene:rut / 32406 FlyBaseID:FBgn0003301 Length:2248 Species:Drosophila melanogaster
Sequence 2:NP_037302.1 Gene:Gucy2c / 25711 RGDID:2771 Length:1072 Species:Rattus norvegicus


Alignment Length:302 Identity:80/302 - (26%)
Similarity:146/302 - (48%) Gaps:51/302 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   207 MERAQRRTFLDTRN---CIASRLEI-QDENEKLERLLLSVLPQHVAMQMK-NDILSPVAGQFHRI 266
            |:...||..|.:||   .:..|.:: :.|.::.:.|...:||:.|...:| ..|:.|        
  Rat   760 MDTLIRRLQLYSRNLEHLVEERTQLYKAERDRADHLNFMLLPRLVVKSLKEKGIVEP-------- 816

  Fly   267 YIQKHENVSILFADIVGFTVLSSQCSAQELVRLLNELFGRFDQLAHDNHCLRIKILGDCYYCVSG 331
              :.:|.|:|.|:||||||.:....:..|:|.:||:::..|||:...:...:::.:||.|...||
  Rat   817 --ELYEEVTIYFSDIVGFTTICKYSTPMEVVDMLNDIYKSFDQIVDHHDVYKVETIGDAYVVASG 879

  Fly   332 LPEPRKD-HAKCAVEMGLDMIDAIAT--VVEATDVILNMRVGIHTGRVLCGVLGLRKWQFDVWSN 393
            ||....: ||....:|.||::..:.|  :.....:.:.:|:|:|:|....||:|::..::.::.:
  Rat   880 LPMRNGNRHAVDISKMALDILSFMGTFELEHLPGLPVWIRIGVHSGPCAAGVVGIKMPRYCLFGD 944

  Fly   394 DVTLANHMESGGEPGRVHVTRATLDSLSGE-----YEVEAGHGDERSSYLRDHGVDTFF------ 447
            .|..|:.|||.|.|.|:|::.:|:..|...     |||..      .:||:..|.:|.:      
  Rat   945 TVNTASRMESTGLPLRIHMSSSTIAILRRTDCQFLYEVRG------ETYLKGRGTETTYWLTGMK 1003

  Fly   448 -----IVPPP----HRR-----KPLMLNTLGVRSAIG--SRR 473
                 :..||    .:|     ..::::.|..|.|.|  |||
  Rat  1004 DQEYNLPTPPTVENQQRLQTEFSDMIVSALQKRQASGVKSRR 1045

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rutNP_511156.2 AC_N <17..255 CDD:292831 13/52 (25%)
CYCc 230..425 CDD:214485 56/203 (28%)
Guanylate_cyc 266..438 CDD:278633 51/179 (28%)
DUF1053 624..696 CDD:283888
SLC5-6-like_sbd <742..>893 CDD:294310
CYCc 924..1134 CDD:214485
Guanylate_cyc 954..1151 CDD:278633
Gucy2cNP_037302.1 Periplasmic_Binding_Protein_Type_1 34..414 CDD:299141
PKc_like 479..749 CDD:304357
STYKc 501..744 CDD:214568
CYCc 787..978 CDD:214485 56/200 (28%)
Guanylate_cyc 814..1001 CDD:278633 56/202 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.