DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rut and Npr3

DIOPT Version :9

Sequence 1:NP_511156.2 Gene:rut / 32406 FlyBaseID:FBgn0003301 Length:2248 Species:Drosophila melanogaster
Sequence 2:XP_006232107.1 Gene:Npr3 / 25339 RGDID:3196 Length:652 Species:Rattus norvegicus


Alignment Length:241 Identity:42/241 - (17%)
Similarity:73/241 - (30%) Gaps:87/241 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   510 AASALGGGVSVGGGGGGGGGGVARGSTCEANSGNVQVSEKGSRKVIRLQKI-------------- 560
            |.:.|.||.|.|||..|.|                  :.:..|:.:..|||              
  Rat   132 ARALLAGGASSGGGDTGPG------------------NRRREREALAAQKIEVLVLLPRDDSYLF 178

  Fly   561 -LHATPPPHGMGYGSVVGSGGG-------------VDSGISGGGGCVS----GGIAGGGGVQVTV 607
             |....|.......||.|:|.|             .:....|.....|    ...|.|....:.:
  Rat   179 SLARVRPAIEYALRSVEGNGTGRKLLPPGTRFQVAYEDSDCGNRALFSLVDRVAAARGAKPDLIL 243

  Fly   608 GTNPNSTASTISRIHRH---------------NHKNNK---------SQSKVADKFKRPFRKRH- 647
            |......|:.::|:..|               .||:.:         :.:|:.:.....||..| 
  Rat   244 GPVCEYAAAPVARLASHWDLPMLSAGALAAGFQHKDTEYSHLTRVAPAYAKMGEMMLALFRHHHW 308

  Fly   648 SVAAHHQPTNRVNR------------FLSQAINARSVDCDKSEHVD 681
            |.||.....:::.|            |..:.::..:.:.|:::.:|
  Rat   309 SRAALLYSDDKLERNCYFTLEGVHEVFQEEGLHTSAYNFDETKDLD 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rutNP_511156.2 AC_N <17..255 CDD:292831
CYCc 230..425 CDD:214485
Guanylate_cyc 266..438 CDD:278633
DUF1053 624..696 CDD:283888 14/95 (15%)
SLC5-6-like_sbd <742..>893 CDD:294310
CYCc 924..1134 CDD:214485
Guanylate_cyc 954..1151 CDD:278633
Npr3XP_006232107.1 PBP1_NPR_C_like 165..556 CDD:107381 28/190 (15%)
ANF_receptor 182..535 CDD:279440 27/173 (16%)
TM_EphA1 587..618 CDD:214014
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.