DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rut and Gucy1b2

DIOPT Version :9

Sequence 1:NP_511156.2 Gene:rut / 32406 FlyBaseID:FBgn0003301 Length:2248 Species:Drosophila melanogaster
Sequence 2:NP_001257640.1 Gene:Gucy1b2 / 25206 RGDID:2770 Length:742 Species:Rattus norvegicus


Alignment Length:429 Identity:112/429 - (26%)
Similarity:193/429 - (44%) Gaps:71/429 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   811 RKCSLPQYVSL---SAAFAFLSVSVFLRLPIIFKS-------------LLVLGMGTIYGLFIELS 859
            :|.:|.:|.|:   ...|...|:..|:....:.|:             :|.| .|.:  :::|..
  Rat   302 QKFALDEYFSIIHPQVTFNISSICKFINSQFVLKTRKEMMPKARKSQPMLKL-RGQM--IWMESL 363

  Fly   860 HQNIFECYD-----NRVNASIPLHLISLARIAIFMIAILVHGRLVEGTARLDFLWQLQASQEKKE 919
            ...||.|..     ..:..| .:||..:|........||::.:.:   |.::...||:  ::|:|
  Rat   364 RCMIFMCSPKLRSLQELEES-KMHLSDIAPHDTTRDLILLNQQRL---AEMELSCQLE--KKKEE 422

  Fly   920 MDVL-------QESNKRILHNLLPAHVAAHFLDAQFRNNMELYHQSYAKVGVIFASVPNFNEFYT 977
            :.||       ::..:.:|:.:||.|||     .|.:...::....:....::|:.|..|    |
  Rat   423 LRVLSNHLAIEKKKTETLLYAMLPEHVA-----NQLKEGRKVAAGEFETCTILFSDVVTF----T 478

  Fly   978 EMDGSDQGLECLRLLNEIIADFDELLKEDRFRGIDKIKTVGSTYMAVVGLIPEYKIQPNDPNSVR 1042
            .:..:.:.::.:.:||.:.:.||.|..   ...:.|::|:|..||.|.|:          |..|.
  Rat   479 NICAACEPIQIVNMLNSMYSKFDRLTS---VHDVYKVETIGDAYMVVGGV----------PVPVE 530

  Fly  1043 RHMTALIEYVKAMRHSLQEI-NSHSYNNFMLRVGINIGPVVAGVIGARKPQYDIWGNTVNVASRM 1106
            .|...:..:...||.|.:|: |..:.....:||||:.|||:|||:|.:.|:|.::|:|||.||||
  Rat   531 SHAQRVANFALGMRISAKEVMNPVTGEPIQIRVGIHTGPVLAGVVGDKMPRYCLFGDTVNTASRM 595

  Fly  1107 DSTGVPGYSQVTQEVVDSLVGSHFEFRCRGTIKVKGKGDMVTYFLCDSGNKSLNGEVRNAMSLPQ 1171
            :|.|:|....::.....:|....||...||.|:|||||.|.||||.    ::||......|..|.
  Rat   596 ESHGLPSKVHLSPTAHRALKNKGFEIVRRGEIEVKGKGKMTTYFLI----QNLNATEDEIMGRPS 656

  Fly  1172 SLHAPDYYMKVSQFPENRVNTDTYSKKENGH---LYAGN 1207
               ||....:|.. |.|:|.......:...|   :|.|:
  Rat   657 ---APADGKEVCT-PGNQVRKSPAVPRNTDHQQQVYKGD 691

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rutNP_511156.2 AC_N <17..255 CDD:292831
CYCc 230..425 CDD:214485
Guanylate_cyc 266..438 CDD:278633
DUF1053 624..696 CDD:283888
SLC5-6-like_sbd <742..>893 CDD:294310 19/102 (19%)
CYCc 924..1134 CDD:214485 58/210 (28%)
Guanylate_cyc 954..1151 CDD:278633 62/197 (31%)
Gucy1b2NP_001257640.1 HNOB 2..163 CDD:285002
HNOBA 267..453 CDD:285003 34/164 (21%)
CYCc 432..622 CDD:214485 58/211 (27%)
Guanylate_cyc 459..642 CDD:278633 64/203 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.