DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rut and Gucy2f

DIOPT Version :9

Sequence 1:NP_511156.2 Gene:rut / 32406 FlyBaseID:FBgn0003301 Length:2248 Species:Drosophila melanogaster
Sequence 2:NP_001007577.1 Gene:Gucy2f / 245650 MGIID:105119 Length:1108 Species:Mus musculus


Alignment Length:278 Identity:87/278 - (31%)
Similarity:137/278 - (49%) Gaps:38/278 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   227 EIQDENEKLERLLLSVLPQHVAMQMKNDILSPVAGQFHRIYIQKHENVSILFADIVGFTVLSSQC 291
            |::.|.:|.|:||..:||..||..:|........|         .:.|::.|:||||||.:|:..
Mouse   845 ELEIEKQKTEKLLTQMLPLSVAESLKKGCTVEPEG---------FDLVTLYFSDIVGFTTISAMS 900

  Fly   292 SAQELVRLLNELFGRFDQLAHDNHCLRIKILGDCYYCVSGLPEPR-KDHAKCAVEMGLDMIDAIA 355
            ...|:|.|||:|:..||.:...:...:::.:||.|...||||:.. ..||.....|.||::.::.
Mouse   901 EPIEVVDLLNDLYTLFDAIIGSHDVYKVETIGDAYMVASGLPKRNGSRHAAEIANMSLDILSSVG 965

  Fly   356 T--VVEATDVILNMRVGIHTGRVLCGVLGLRKWQFDVWSNDVTLANHMESGGEPGRVHVTRAT-- 416
            |  :....:|.:.:|:|:|:|.|:.||:||...::.::.:.|..|:.|||.|.|.|:||:.:|  
Mouse   966 TFKMRHMPEVPVRIRIGLHSGPVVAGVVGLTMPRYCLFGDTVNTASRMESTGLPYRIHVSLSTVT 1030

  Fly   417 -LDSLSGEYEVE-------AGHGDERSSYL-RDHGVDTFFIVPPP--------HRRKPLMLNTLG 464
             |.:||..||||       .|.|.|.:.:| ...|......||||        |..:|..:    
Mouse  1031 ILQTLSEGYEVELRGRTELKGKGTEETFWLVGKKGFTKPLPVPPPVGKDGQVGHGLQPAEI---- 1091

  Fly   465 VRSAIGSRRKLSFRNVSN 482
               |...|||...:.|.|
Mouse  1092 ---AAFQRRKAERQLVRN 1106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rutNP_511156.2 AC_N <17..255 CDD:292831 11/27 (41%)
CYCc 230..425 CDD:214485 65/200 (33%)
Guanylate_cyc 266..438 CDD:278633 61/184 (33%)
DUF1053 624..696 CDD:283888
SLC5-6-like_sbd <742..>893 CDD:294310
CYCc 924..1134 CDD:214485
Guanylate_cyc 954..1151 CDD:278633
Gucy2fNP_001007577.1 PBP1_sensory_GC_DEF-like 54..435 CDD:380594
PKc_like 545..815 CDD:419665
HNOBA <824..869 CDD:400168 10/23 (43%)
CYCc 848..1040 CDD:214485 65/200 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.