DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rut and gcy-25

DIOPT Version :9

Sequence 1:NP_511156.2 Gene:rut / 32406 FlyBaseID:FBgn0003301 Length:2248 Species:Drosophila melanogaster
Sequence 2:NP_001294116.1 Gene:gcy-25 / 191653 WormBaseID:WBGene00001549 Length:1034 Species:Caenorhabditis elegans


Alignment Length:331 Identity:83/331 - (25%)
Similarity:150/331 - (45%) Gaps:87/331 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   874 SIPLHLISL----------ARIAIFMIAILVH---GRLVEGT---ARLDFLWQLQASQEK----- 917
            |..:.|:|:          ||.|:..|...|:   |:.|:||   ..::.:.:..|:.|:     
 Worm   715 SFTMRLLSIIQQCWLYKPAARPALIKITDAVNREFGQDVKGTLIDQMIEMIDEYSANLEQIVAER 779

  Fly   918 -KEMDVLQESNKRILHNLLPAHVAAHFLDAQFRNNMELYHQSYAKVGVIFASVPNFNEFYTEMDG 981
             :|::......:.:|:.|||..||     ...|:...:..:.::.|.::...|..|.:|      
 Worm   780 TRELEQDMSVTENLLYQLLPKSVA-----DSIRSGKTVVPEQHSSVTLLVVDVCQFTKF------ 833

  Fly   982 SDQGLEC--------LRLLNEIIADFDELLKEDRFRGIDKIKTVGSTYMAVVGLIPEYKIQPNDP 1038
                  |        |..|.|:.:.||.::::::   ..|::.||..|:...| |||.       
 Worm   834 ------CEAFIPVHILETLQELYSSFDNIVQKNK---AFKVENVGDAYLICSG-IPEM------- 881

  Fly  1039 NSVRRHMTALIE-------YVKAMR------HSLQEINSHSYNNFMLRVGINIGPVVAGVIGARK 1090
             |..||:..:.:       ::|..:      |:||           :::||..|.|.||::|:..
 Worm   882 -SGFRHLREICKISLKLQAFMKTFKVRHRPSHTLQ-----------IKMGITSGAVAAGILGSTA 934

  Fly  1091 PQYDIWGNTVNVASRMDSTGVPGYSQVTQEVVDSLVGS--HFEFRCRGTIKVKGKGDMVTYFLCD 1153
            |::.|:|:|||:|.||.|||.||..|:::...::|:..  .|....||.|.|||||..:|::|  
 Worm   935 PRFCIFGDTVNMACRMASTGNPGSIQLSELTANTLMEKFPSFMLEERGMIDVKGKGACLTFWL-- 997

  Fly  1154 SGNKSL 1159
            :|.|.:
 Worm   998 TGEKDI 1003

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rutNP_511156.2 AC_N <17..255 CDD:292831
CYCc 230..425 CDD:214485
Guanylate_cyc 266..438 CDD:278633
DUF1053 624..696 CDD:283888
SLC5-6-like_sbd <742..>893 CDD:294310 7/28 (25%)
CYCc 924..1134 CDD:214485 56/232 (24%)
Guanylate_cyc 954..1151 CDD:278633 58/219 (26%)
gcy-25NP_001294116.1 PBP1_iGluR_N_LIVBP_like 56..>230 CDD:107346
PKc_like 473..746 CDD:304357 7/30 (23%)
SPS1 474..>736 CDD:223589 4/20 (20%)
HNOBA <764..805 CDD:285003 9/45 (20%)
CYCc 790..976 CDD:214485 55/225 (24%)
Nucleotidyl_cyc_III 812..999 CDD:299850 59/223 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.