Sequence 1: | NP_511156.2 | Gene: | rut / 32406 | FlyBaseID: | FBgn0003301 | Length: | 2248 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_506097.3 | Gene: | gcy-13 / 191646 | WormBaseID: | WBGene00001539 | Length: | 1028 | Species: | Caenorhabditis elegans |
Alignment Length: | 208 | Identity: | 67/208 - (32%) |
---|---|---|---|
Similarity: | 118/208 - (56%) | Gaps: | 15/208 - (7%) |
- Green bases have known domain annotations that are detailed below.
Fly 227 EIQDENEKLERLLLSVLPQHVAMQMKNDILSPVAGQFHRIYIQKHENVSILFADIVGFTVLSSQC 291
Fly 292 SAQELVRLLNELFGRFDQLAHDNHCLRIKILGDCYYCVSGLPEPR-KDHAKCAVEMGLDMIDAIA 355
Fly 356 T--VVEATDVILNMRVGIHTGRVLCGVLGLRKWQFDVWSNDVTLANHMESGGEPGRVHVTRATLD 418
Fly 419 ---SLSGEYEVEA 428 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
rut | NP_511156.2 | AC_N | <17..255 | CDD:292831 | 11/27 (41%) |
CYCc | 230..425 | CDD:214485 | 64/200 (32%) | ||
Guanylate_cyc | 266..438 | CDD:278633 | 54/169 (32%) | ||
DUF1053 | 624..696 | CDD:283888 | |||
SLC5-6-like_sbd | <742..>893 | CDD:294310 | |||
CYCc | 924..1134 | CDD:214485 | |||
Guanylate_cyc | 954..1151 | CDD:278633 | |||
gcy-13 | NP_506097.3 | PBP1_NPR_GC_like | 3..397 | CDD:107347 | |
ANF_receptor | 13..368 | CDD:279440 | |||
PKc_like | 548..770 | CDD:304357 | |||
HNOBA | <797..829 | CDD:285003 | 10/23 (43%) | ||
CYCc | 808..1000 | CDD:214485 | 64/200 (32%) | ||
Guanylate_cyc | 835..1022 | CDD:278633 | 54/169 (32%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG2114 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |