DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rut and gcy-13

DIOPT Version :9

Sequence 1:NP_511156.2 Gene:rut / 32406 FlyBaseID:FBgn0003301 Length:2248 Species:Drosophila melanogaster
Sequence 2:NP_506097.3 Gene:gcy-13 / 191646 WormBaseID:WBGene00001539 Length:1028 Species:Caenorhabditis elegans


Alignment Length:208 Identity:67/208 - (32%)
Similarity:118/208 - (56%) Gaps:15/208 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   227 EIQDENEKLERLLLSVLPQHVAMQMKNDILSPVAGQFHRIYIQKHENVSILFADIVGFTVLSSQC 291
            |:.:|.:|.:.||..:|||.||.::|       .||  .:..:..|:|:|.|:|:||||||:::.
 Worm   805 ELVEEKKKSDILLYRMLPQQVAERLK-------LGQ--SVEPEAFESVTIFFSDVVGFTVLANKS 860

  Fly   292 SAQELVRLLNELFGRFDQLAHDNHCLRIKILGDCYYCVSGLPEPR-KDHAKCAVEMGLDMIDAIA 355
            :..::|.|||:|:..||.:...|...:::.:||.|..|||||... .:|......|.|:::|::.
 Worm   861 TPLQVVNLLNDLYTTFDAIIEKNDSYKVETIGDAYLVVSGLPRRNGTEHVANIANMSLELMDSLQ 925

  Fly   356 T--VVEATDVILNMRVGIHTGRVLCGVLGLRKWQFDVWSNDVTLANHMESGGEPGRVHVTRATLD 418
            .  :.......:.:|:|:|:|..:.||:||...::.::.:.|..|:.|||.|:||.:|::....|
 Worm   926 AFKIPHLPQEKVQIRIGMHSGSCVAGVVGLTMPRYCLFGDTVNTASRMESNGKPGFIHLSSDCYD 990

  Fly   419 ---SLSGEYEVEA 428
               ||..||..|:
 Worm   991 LLTSLYKEYNTES 1003

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rutNP_511156.2 AC_N <17..255 CDD:292831 11/27 (41%)
CYCc 230..425 CDD:214485 64/200 (32%)
Guanylate_cyc 266..438 CDD:278633 54/169 (32%)
DUF1053 624..696 CDD:283888
SLC5-6-like_sbd <742..>893 CDD:294310
CYCc 924..1134 CDD:214485
Guanylate_cyc 954..1151 CDD:278633
gcy-13NP_506097.3 PBP1_NPR_GC_like 3..397 CDD:107347
ANF_receptor 13..368 CDD:279440
PKc_like 548..770 CDD:304357
HNOBA <797..829 CDD:285003 10/23 (43%)
CYCc 808..1000 CDD:214485 64/200 (32%)
Guanylate_cyc 835..1022 CDD:278633 54/169 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.