DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rut and gcy-9

DIOPT Version :9

Sequence 1:NP_511156.2 Gene:rut / 32406 FlyBaseID:FBgn0003301 Length:2248 Species:Drosophila melanogaster
Sequence 2:NP_509897.3 Gene:gcy-9 / 191645 WormBaseID:WBGene00001536 Length:1081 Species:Caenorhabditis elegans


Alignment Length:270 Identity:82/270 - (30%)
Similarity:138/270 - (51%) Gaps:41/270 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   896 GRLVEGTARLDFLWQLQASQEKKEMD---VLQESNK---RILHNLLPAHVAAHFLDAQFRNNMEL 954
            |.||:...::  :.:..|:.|....|   :|:|:.|   |:|:::||..:|     ...:....:
 Worm   832 GSLVDQMMKM--MEEYTANLENMVRDRTALLEEAQKQADRLLNSMLPKSIA-----EDLKIGKPV 889

  Fly   955 YHQSYAKVGVIFASVPNFNEFYTEMDGSDQGLECLRLLNEIIADFDELL-KEDRFRGIDKIKTVG 1018
            ..|.|:...|:|:.:..|    |.:..:...|:.:..||::.:.||.:: |.|.:    |::|:|
 Worm   890 LPQLYSCATVLFSDIRGF----TRISSTSTPLQVVTFLNDMFSGFDAIIAKHDAY----KVETIG 946

  Fly  1019 STYMAVVGLIPEYKIQPNDPN--SVRRHMTALIEYVKAMRHSLQEINSHSYNNFMLRVGINIGPV 1081
            ..||.|.| :|......:..|  .|...|.|.|...| :.|..:|:       .|:|:|.:.|||
 Worm   947 DAYMIVSG-VPTENGNSHAQNIADVALKMRAFICNFK-LAHRPEEL-------MMVRIGFHSGPV 1002

  Fly  1082 VAGVIGARKPQYDIWGNTVNVASRMDSTGVPGYSQVTQEVVDSLVGSH-----FEFRCRGTIKVK 1141
            .|||:|...|:|.::|:|||.||||:||||....|:::...:.|   |     |:...||.|:||
 Worm  1003 AAGVVGLAAPRYCLFGDTVNTASRMESTGVANKIQISEGAYNLL---HCFFPQFQMVERGKIEVK 1064

  Fly  1142 GKGDMVTYFL 1151
            |||:.:||:|
 Worm  1065 GKGECLTYYL 1074

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rutNP_511156.2 AC_N <17..255 CDD:292831
CYCc 230..425 CDD:214485
Guanylate_cyc 266..438 CDD:278633
DUF1053 624..696 CDD:283888
SLC5-6-like_sbd <742..>893 CDD:294310
CYCc 924..1134 CDD:214485 64/220 (29%)
Guanylate_cyc 954..1151 CDD:278633 67/204 (33%)
gcy-9NP_509897.3 Periplasmic_Binding_Protein_Type_1 66..416 CDD:299141
ANF_receptor 69..404 CDD:279440
PKc_like 550..820 CDD:304357
HNOBA <837..883 CDD:285003 11/52 (21%)
CYCc 862..1054 CDD:214485 63/216 (29%)
Guanylate_cyc 889..1076 CDD:278633 68/206 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.