DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rut and gcy-3

DIOPT Version :9

Sequence 1:NP_511156.2 Gene:rut / 32406 FlyBaseID:FBgn0003301 Length:2248 Species:Drosophila melanogaster
Sequence 2:NP_496037.1 Gene:gcy-3 / 191641 WormBaseID:WBGene00001530 Length:1140 Species:Caenorhabditis elegans


Alignment Length:231 Identity:67/231 - (29%)
Similarity:128/231 - (55%) Gaps:21/231 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   227 EIQDENEKLERLLLSVLPQHVAMQMKNDILSPVAGQFHRIYIQKHENVSILFADIVGFTVLSSQC 291
            |:..|.:|.:.||..:||:.||.::|       |||  .:..:..::|::.|:|:|.||:|:|:|
 Worm   858 ELTLEKKKADLLLSRMLPKQVAERLK-------AGQ--TVEPEGFDSVTVFFSDVVKFTILASKC 913

  Fly   292 SAQELVRLLNELFGRFDQLAHDNHCLRIKILGDCYYCVSGLPEPRK-DHAKCAVEMGLDMIDAIA 355
            :..::|.|||:|:..||.:..::...:::.:||.|.||||||.... :|.|..|:|.|..:|...
 Worm   914 TPFQVVNLLNDLYSNFDTIIEEHGVYKVESIGDGYLCVSGLPTRNGFNHIKQIVDMSLKFMDYCK 978

  Fly   356 T--VVEATDVILNMRVGIHTGRVLCGVLGLRKWQFDVWSNDVTLANHMESGGEPGRVHVTR---- 414
            .  :.......:.:|:|:::|..:.||:||...::.::.:.|..|:.|||.|:|..:|:|.    
 Worm   979 NFKIPHLPRERVELRIGVNSGPCVAGVVGLSMPRYCLFGDTVNTASRMESNGKPSLIHLTSDAHL 1043

  Fly   415 ATLDSLSGEYEVEAGHGDERSSYLRDHGV-DTFFIV 449
            ..:.....:||..: .|:   ..::..|| :||:::
 Worm  1044 LLMKHFPHQYETNS-RGE---VIIKGKGVMETFWVL 1075

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rutNP_511156.2 AC_N <17..255 CDD:292831 10/27 (37%)
CYCc 230..425 CDD:214485 59/201 (29%)
Guanylate_cyc 266..438 CDD:278633 50/178 (28%)
DUF1053 624..696 CDD:283888
SLC5-6-like_sbd <742..>893 CDD:294310
CYCc 924..1134 CDD:214485
Guanylate_cyc 954..1151 CDD:278633
gcy-3NP_496037.1 PBP1_NPR_GC_like 36..453 CDD:107347
ANF_receptor 54..433 CDD:279440
PKc_like 554..823 CDD:304357
HNOBA <839..882 CDD:285003 9/23 (39%)
CYCc 861..1051 CDD:214485 59/198 (30%)
Guanylate_cyc 888..1076 CDD:278633 54/192 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.