DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rut and Npr3

DIOPT Version :9

Sequence 1:NP_511156.2 Gene:rut / 32406 FlyBaseID:FBgn0003301 Length:2248 Species:Drosophila melanogaster
Sequence 2:NP_032754.2 Gene:Npr3 / 18162 MGIID:97373 Length:536 Species:Mus musculus


Alignment Length:273 Identity:47/273 - (17%)
Similarity:77/273 - (28%) Gaps:108/273 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   906 DFLWQLQASQEKKEMDVLQESNKRIL-----HNLLPAHVAAHFLDAQFRNNMELY---------- 955
            |.:..:|.|:....|....::.:||:     |.:.....|..        |:||:          
Mouse   241 DIVRYIQGSERVVIMCASGDTIRRIMLAVHRHGMTSGDYAFF--------NIELFNSSSYGDGSW 297

  Fly   956 -----HQSYAK--------VGVIFASVPNFNEFYTEMDGS--DQGLECLRLLNEIIADFDELLKE 1005
                 |.|.||        |.::....|.|.:|..|:..|  .|||.....:|..:..|.:    
Mouse   298 RRGDKHDSEAKQAYSSLQTVTLLRTVKPEFEKFSMEVKSSVEKQGLNEEDYVNMFVEGFHD---- 358

  Fly  1006 DRFRGIDKIKTVGSTYMAVVGLIPEYKIQPNDPNSVRRHMTALIEYVKAMRHSLQ---------E 1061
                                                     |::.||.|:...|:         :
Mouse   359 -----------------------------------------AILLYVLALHEVLRAGYSKKDGGK 382

  Fly  1062 INSHSYNNFMLRVGINIGPVVAGVIGARKPQYDIWGNTVNVASRMDSTGVPGYSQVTQEVVDSLV 1126
            |...::|.....:.   |.|.....|.|...:.:...|...|.             ||||:....
Mouse   383 IIQQTWNRTFEGIA---GQVSIDANGDRYGDFSVVAMTDTEAG-------------TQEVIGDYF 431

  Fly  1127 GSHFEFRCRGTIK 1139
            |....|:.|..:|
Mouse   432 GKEGRFQMRSNVK 444

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rutNP_511156.2 AC_N <17..255 CDD:292831
CYCc 230..425 CDD:214485
Guanylate_cyc 266..438 CDD:278633
DUF1053 624..696 CDD:283888
SLC5-6-like_sbd <742..>893 CDD:294310
CYCc 924..1134 CDD:214485 41/248 (17%)
Guanylate_cyc 954..1151 CDD:278633 37/220 (17%)
Npr3NP_032754.2 PBP1_NPR_C_like 49..440 CDD:107381 45/267 (17%)
ANF_receptor 66..419 CDD:279440 38/233 (16%)
TM_EphA1 471..502 CDD:214014
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.