DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rut and gcy-32

DIOPT Version :9

Sequence 1:NP_511156.2 Gene:rut / 32406 FlyBaseID:FBgn0003301 Length:2248 Species:Drosophila melanogaster
Sequence 2:NP_506452.5 Gene:gcy-32 / 179887 WormBaseID:WBGene00001552 Length:684 Species:Caenorhabditis elegans


Alignment Length:349 Identity:97/349 - (27%)
Similarity:158/349 - (45%) Gaps:82/349 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   867 YDNRVNASIPLHLISLARIAIFMIAILVHGRLVEGTARLDFLWQLQASQEK-----KEMDVLQES 926
            |..|:.| :|||      .|...:.:|...||.:....|    ||:|:.|:     :|:::.::.
 Worm   370 YGMRLTA-MPLH------DATRDLILLNQQRLSDVEVNL----QLEANNEQLETMTRELELERQK 423

  Fly   927 NKRILHNLLPAHVAAHFLDAQFRNNMELYHQSYAKVGVIFASVPNFNEFYTEMDGSDQGLECLRL 991
            ...||.::||..:|...|..:.....|  |::    .|:|..:|.|.:...:....|    .:.:
 Worm   424 TDSILKDMLPRRIAQQLLSGEHIEACE--HEA----TVMFCDLPAFQQAIPQCSPKD----IVNM 478

  Fly   992 LNEIIADFDELLKEDRFRGIDKIKTVGSTYMAVVGLIPEYKIQPNDPNSVRRHMTALIEYVKAMR 1056
            ||||....|.::.   .||:.|::||..:||||.| ||:|     .|           |:.:.|.
 Worm   479 LNEIFRKLDRIVV---IRGVYKVETVSDSYMAVSG-IPDY-----TP-----------EHAENMC 523

  Fly  1057 H--------SLQEINSHSYNNFMLRVGINIGPVVAGVIGARKPQYDIWGNTVNVASRMDSTGVPG 1113
            |        :...|:..|...|:||:||:.|.:.|||:|...|:|.::|.||.:||:|:|.|:.|
 Worm   524 HVALGMMWEARSVIDPVSKTPFLLRIGIHSGTITAGVVGTVHPKYCLFGETVTLASQMESLGMAG 588

  Fly  1114 YSQVT----QEVVDSLVGSHFEFRCRGTIKVKGKGDMVTYFLCDS-------------------- 1154
            ..|.:    |:.:::   ..|||..||.|.||.:|...||||..|                    
 Worm   589 KIQCSKWAYQKAMET---GRFEFSPRGRIDVKQRGLTETYFLTRSLKKSIWEIIDHDRDINVNSI 650

  Fly  1155 -GNKSLNGEVRNAMSLPQSLHAPD 1177
             |.:.|...:.||:::..:|..||
 Worm   651 EGYEELETAIENAVTIKSALPRPD 674

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rutNP_511156.2 AC_N <17..255 CDD:292831
CYCc 230..425 CDD:214485
Guanylate_cyc 266..438 CDD:278633
DUF1053 624..696 CDD:283888
SLC5-6-like_sbd <742..>893 CDD:294310 7/25 (28%)
CYCc 924..1134 CDD:214485 63/221 (29%)
Guanylate_cyc 954..1151 CDD:278633 64/208 (31%)
gcy-32NP_506452.5 HNOB 3..167 CDD:285002
HNOBA 226..440 CDD:285003 21/80 (26%)
CYCc 419..608 CDD:214485 61/221 (28%)
Guanylate_cyc 452..627 CDD:278633 63/205 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.