DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rut and gcy-18

DIOPT Version :9

Sequence 1:NP_511156.2 Gene:rut / 32406 FlyBaseID:FBgn0003301 Length:2248 Species:Drosophila melanogaster
Sequence 2:NP_502449.2 Gene:gcy-18 / 178237 WormBaseID:WBGene00001543 Length:1113 Species:Caenorhabditis elegans


Alignment Length:304 Identity:90/304 - (29%)
Similarity:147/304 - (48%) Gaps:49/304 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   881 SLARIAIFMIAIL-VHGRLVEGTARLDFLWQLQASQEK---KEMDVLQESNKR---ILHNLLPAH 938
            |:.|:.:....:| ..|.||:...::  :.|...:.||   :...:|:|:|.|   :|..||||:
 Worm   836 SIRRVRLNTEM
VLKTKGSLVDQMMKM--MEQYANNLEKLVAERTGMLEEANIRADQLLTQLLPAY 898

  Fly   939 VAAHFLDAQFRNNMELYHQSYAKVGVIFASVPNFNEFYTEMDGSDQGLECLRLLNEIIADFDELL 1003
            ||     .:.:....:..:.|:...::|:.:..|.   |...||.. ||.:.:||.:...|||.:
 Worm   899 VA-----NELKMGRSVAPKLYSSATILFSDIVGFT---TICSGSTP-LEVVNMLNGLYTGFDECI 954

  Fly  1004 KEDRFRGIDKIKTVGSTYMAVVGLIPEYKIQPNDPNSVRRHMTALIEYVKAMRHSL--QEINSHS 1066
            ..::..   |::|:|..||.|.| |||    .|:.|..|......::    ||..|  .:|....
 Worm   955 TRNKSY---KVETIGDAYMVVSG-IPE----ENEYNHSRNIANTALD----MRQYLTGYQIPHRP 1007

  Fly  1067 YNNFMLRVGINIGPVVAGVIGARKPQYDIWGNTVNVASRMDSTGVPGYSQVTQEVVDSLVGSHFE 1131
            .:....|.|.:.|.|.|||:|...|:|.::|:||||:|||:|||.||..|:::|       :|..
 Worm  1008 THRVRCRWGFHTGSVAAGVVGLTCPRYCLFGDTVNVSSRMESTGTPGMIQMSEE-------AHMH 1065

  Fly  1132 FRC---------RGTIKVKGKGDMVTYFLCDS-GNKSLNGEVRN 1165
            .|.         ||.::|||||...|::|.|. |:.|....::|
 Worm  1066 IRAHHPVFTTTERGEVQVKGKGTCRTFWLEDRVGDASTTNYIQN 1109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rutNP_511156.2 AC_N <17..255 CDD:292831
CYCc 230..425 CDD:214485
Guanylate_cyc 266..438 CDD:278633
DUF1053 624..696 CDD:283888
SLC5-6-like_sbd <742..>893 CDD:294310 2/11 (18%)
CYCc 924..1134 CDD:214485 66/214 (31%)
Guanylate_cyc 954..1151 CDD:278633 65/207 (31%)
gcy-18NP_502449.2 Periplasmic_Binding_Protein_Type_1 87..448 CDD:299141
ANF_receptor 87..395 CDD:279440
PKc_like 549..846 CDD:304357 2/9 (22%)
HNOBA <857..903 CDD:285003 14/52 (27%)
CYCc 882..1073 CDD:214485 67/218 (31%)
Guanylate_cyc 909..1095 CDD:278633 65/208 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.