DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rut and gcy-8

DIOPT Version :9

Sequence 1:NP_511156.2 Gene:rut / 32406 FlyBaseID:FBgn0003301 Length:2248 Species:Drosophila melanogaster
Sequence 2:NP_501324.2 Gene:gcy-8 / 177584 WormBaseID:WBGene00001535 Length:1152 Species:Caenorhabditis elegans


Alignment Length:309 Identity:95/309 - (30%)
Similarity:157/309 - (50%) Gaps:47/309 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   881 SLARIAIFMIAIL-VHGRLVEGTARLDFLWQLQASQEK---KEMDVLQESNK---RILHNLLPAH 938
            ||.||.:.:...| :.|.||:...|:  :.|...:.||   :...:|:|:|:   |:|..||||:
 Worm   845 SLRRIK
LNVETYLNIKGSLVDQMTRM--MEQYANNLEKLVAERTGMLEEANQRADRLLSQLLPAY 907

  Fly   939 VAAHFLDAQFRNNMELYH----QSYAKVGVIFASVPNFNEFYTEMDGSDQGLECLRLLNEIIADF 999
            ||         |.::|..    :::....|:|:.:..|    |||..:...||.:.:||.|...|
 Worm   908 VA---------NELKLGRPVPPKTFTSSTVLFSDIVGF----TEMCQNASPLEVVAVLNGIFDGF 959

  Fly  1000 DELL-KEDRFRGIDKIKTVGSTYMAVVGLIPEYKIQPNDPNSVRRHMTALIEYVKAMRHSLQE-I 1062
            |:.: ::|.:    |::|:|..||.|.| :||        .:..||:..:......:...|.| |
 Worm   960 DQFIARKDAY----KVETIGDAYMVVSG-VPE--------ENGHRHINEIASIALDVHKFLSEFI 1011

  Fly  1063 NSHSYN-NFMLRVGINIGPVVAGVIGARKPQYDIWGNTVNVASRMDSTGVPGYSQVTQEVVDSLV 1126
            ..|..: ....|:|.:.|||.|.|:|...|:|.::|:|||:||||:|...||.:|:::...:.|:
 Worm  1012 VPHKRDTKVQCRLGFHTGPVAAAVVGLNAPRYCLFGDTVNMASRMESNSEPGKTQISETAKNLLL 1076

  Fly  1127 GSHFEFRC--RGTIKVKGKGDMVTYFLCDSGNKSLNGEVRNAMSLPQSL 1173
            ..:.::.|  ||.|.:||||..:||:|  .|.|| .|..|:...|..|:
 Worm  1077 KEYPDYICEQRGEIPIKGKGLCMTYWL--MGTKS-EGSGRSGAYLAPSM 1122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rutNP_511156.2 AC_N <17..255 CDD:292831
CYCc 230..425 CDD:214485
Guanylate_cyc 266..438 CDD:278633
DUF1053 624..696 CDD:283888
SLC5-6-like_sbd <742..>893 CDD:294310 4/11 (36%)
CYCc 924..1134 CDD:214485 64/219 (29%)
Guanylate_cyc 954..1151 CDD:278633 63/205 (31%)
gcy-8NP_501324.2 ANF_receptor 87..442 CDD:279440
Periplasmic_Binding_Protein_Type_1 94..434 CDD:299141
PKc_like 558..850 CDD:304357 3/4 (75%)
HNOBA <866..912 CDD:285003 16/56 (29%)
CYCc 891..1084 CDD:214485 64/218 (29%)
Guanylate_cyc 918..1105 CDD:278633 63/205 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.