DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rut and gcy-29

DIOPT Version :9

Sequence 1:NP_511156.2 Gene:rut / 32406 FlyBaseID:FBgn0003301 Length:2248 Species:Drosophila melanogaster
Sequence 2:NP_001364597.1 Gene:gcy-29 / 175116 WormBaseID:WBGene00007314 Length:1069 Species:Caenorhabditis elegans


Alignment Length:235 Identity:75/235 - (31%)
Similarity:127/235 - (54%) Gaps:14/235 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   194 IGVNVAGLVVNIMMERAQRRTFLDTRNCIASRLEIQDE-NEKLERLLLSVLPQHVAMQMKNDILS 257
            |.:...|.:|:.|| |.......:....:..|.::.:| |.:.||||..:||:|||:::|     
 Worm   804 IALKTKGNLVDSMM-RMMEEYANNLEKLVGERTKLAEEANLRAERLLFQLLPKHVAIELK----- 862

  Fly   258 PVAGQFHRIYIQKHENVSILFADIVGFTVLSSQCSAQELVRLLNELFGRFDQLAHDNHCLRIKIL 322
              ||:  .:..:.:::.:::|:||||||.|.|..:..|:|.|||:|:..||.:...:.|.:::.:
 Worm   863 --AGR--TVAPKMYDSATVMFSDIVGFTKLCSASTPIEVVNLLNKLYSEFDTVISKHDCYKVETI 923

  Fly   323 GDCYYCVSGLP-EPRKDHAK--CAVEMGLDMIDAIATVVEATDVILNMRVGIHTGRVLCGVLGLR 384
            ||.|..|||:| |..:.|..  .||.:|:..:..:..|....|..|.:|:|..:|:|...|:||.
 Worm   924 GDAYMVVSGIPIENGQRHVANISAVTLGIMDLLKVFEVPHRRDYRLTIRLGFASGQVSAAVVGLS 988

  Fly   385 KWQFDVWSNDVTLANHMESGGEPGRVHVTRATLDSLSGEY 424
            ..::.::...|.:|..|||.||.|||.:|..:...|..||
 Worm   989 SPRYCLFGETVNIAAVMESSGEGGRVQITETSKILLENEY 1028

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rutNP_511156.2 AC_N <17..255 CDD:292831 19/61 (31%)
CYCc 230..425 CDD:214485 68/199 (34%)
Guanylate_cyc 266..438 CDD:278633 54/162 (33%)
DUF1053 624..696 CDD:283888
SLC5-6-like_sbd <742..>893 CDD:294310
CYCc 924..1134 CDD:214485
Guanylate_cyc 954..1151 CDD:278633
gcy-29NP_001364597.1 PBP1_NPR_GC-like 27..403 CDD:380575
PKc_like 534..804 CDD:419665 75/235 (32%)
CYCc 840..1033 CDD:214485 68/198 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.