| Sequence 1: | NP_511156.2 | Gene: | rut / 32406 | FlyBaseID: | FBgn0003301 | Length: | 2248 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_446290.1 | Gene: | Npr2 / 116564 | RGDID: | 620851 | Length: | 1047 | Species: | Rattus norvegicus |
| Alignment Length: | 222 | Identity: | 71/222 - (31%) |
|---|---|---|---|
| Similarity: | 121/222 - (54%) | Gaps: | 23/222 - (10%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 230 DENEKLERLLLSVLPQHVAMQMKNDILSPVAGQFHRIYIQKHENVSILFADIVGFTVLSSQCSAQ 294
Fly 295 ELVRLLNELFGRFDQLAHDNHCLRIKILGDCYYCVSGLP-EPRKDHAKCAVEMGLDMIDAIAT-- 356
Fly 357 VVEATDVILNMRVGIHTGRVLCGVLGLRKWQFDVWSNDVTLANHMESGGEPGRVHVTRATLDSLS 421
Fly 422 ----------GEYEVEAGHGDERSSYL 438 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| rut | NP_511156.2 | AC_N | <17..255 | CDD:292831 | 11/24 (46%) |
| CYCc | 230..425 | CDD:214485 | 66/207 (32%) | ||
| Guanylate_cyc | 266..438 | CDD:278633 | 59/184 (32%) | ||
| DUF1053 | 624..696 | CDD:283888 | |||
| SLC5-6-like_sbd | <742..>893 | CDD:294310 | |||
| CYCc | 924..1134 | CDD:214485 | |||
| Guanylate_cyc | 954..1151 | CDD:278633 | |||
| Npr2 | NP_446290.1 | PBP1_NPR_B | 26..421 | CDD:380607 | |
| PK_GC-A_B | 518..792 | CDD:270944 | |||
| HNOBA | <798..846 | CDD:400168 | 9/20 (45%) | ||
| CYCc | 825..1009 | CDD:214485 | 64/192 (33%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_COG2114 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 1 | 1.000 | - | - | ||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 3 | 2.810 | |||||