DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rut and Gucy2f

DIOPT Version :9

Sequence 1:NP_511156.2 Gene:rut / 32406 FlyBaseID:FBgn0003301 Length:2248 Species:Drosophila melanogaster
Sequence 2:NP_446283.1 Gene:Gucy2f / 116556 RGDID:620439 Length:1108 Species:Rattus norvegicus


Alignment Length:278 Identity:88/278 - (31%)
Similarity:137/278 - (49%) Gaps:38/278 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   227 EIQDENEKLERLLLSVLPQHVAMQMKNDILSPVAGQFHRIYIQKHENVSILFADIVGFTVLSSQC 291
            |::.|.:|.|:||..:||..||..:|........|         .:.|::.|:||||||.:|:..
  Rat   845 ELEIEKQKTEKLLTQMLPPSVAESLKKGCTVEPEG---------FDLVTLYFSDIVGFTTISAMS 900

  Fly   292 SAQELVRLLNELFGRFDQLAHDNHCLRIKILGDCYYCVSGLPEPR-KDHAKCAVEMGLDMIDAIA 355
            ...|:|.|||:|:..||.:...:...:::.:||.|...||||:.. ..||.....|.||::.::.
  Rat   901 EPIEVVDLLNDLYTLFDAIIGSHDVYKVETIGDAYMVASGLPKRNGSRHAAEIANMSLDILSSVG 965

  Fly   356 T--VVEATDVILNMRVGIHTGRVLCGVLGLRKWQFDVWSNDVTLANHMESGGEPGRVHVTRAT-- 416
            |  :....:|.:.:|:|:|||.|:.||:||...::.::.:.|..|:.|||.|.|.|:||:.:|  
  Rat   966 TFKMRHMPEVPVRIRIGLHTGPVVAGVVGLTMPRYCLFGDTVNTASRMESTGLPYRIHVSLSTVT 1030

  Fly   417 -LDSLSGEYEVE-------AGHGDERSSYL-RDHGVDTFFIVPPP--------HRRKPLMLNTLG 464
             |.:||..||||       .|.|.|.:.:| ...|......||||        |..:|..:    
  Rat  1031 ILRTLSEGYEVELRGRTELKGKGTEETFWLVGKKGFTKPLPVPPPVGKDGQVGHGLQPAEI---- 1091

  Fly   465 VRSAIGSRRKLSFRNVSN 482
               |...|||...:.|.|
  Rat  1092 ---AAFQRRKAERQLVRN 1106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rutNP_511156.2 AC_N <17..255 CDD:292831 11/27 (41%)
CYCc 230..425 CDD:214485 66/200 (33%)
Guanylate_cyc 266..438 CDD:278633 62/184 (34%)
DUF1053 624..696 CDD:283888
SLC5-6-like_sbd <742..>893 CDD:294310
CYCc 924..1134 CDD:214485
Guanylate_cyc 954..1151 CDD:278633
Gucy2fNP_446283.1 PBP1_sensory_GC_DEF_like 54..435 CDD:107366
ANF_receptor 75..412 CDD:279440
PKc_like 545..815 CDD:304357
TyrKc 565..809 CDD:197581
HNOBA <824..869 CDD:285003 10/23 (43%)
CYCc 848..1040 CDD:214485 66/200 (33%)
Guanylate_cyc 875..1062 CDD:278633 64/195 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.