DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rut and gucy1b1

DIOPT Version :9

Sequence 1:NP_511156.2 Gene:rut / 32406 FlyBaseID:FBgn0003301 Length:2248 Species:Drosophila melanogaster
Sequence 2:XP_004911214.1 Gene:gucy1b1 / 100379900 XenbaseID:XB-GENE-950986 Length:618 Species:Xenopus tropicalis


Alignment Length:207 Identity:70/207 - (33%)
Similarity:121/207 - (58%) Gaps:22/207 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   222 IASRLE-----IQDENEKLERLLLSVLPQHVAMQMKNDILSPVAGQFHRIYIQKHENVSILFADI 281
            :..||:     ::||.:|.:.||.||||..||.::::.  .||..       ::::||:|||:.|
 Frog   372 LTDRLQHTLRALEDEKKKTDTLLYSVLPPSVANELRHK--RPVPA-------KRYDNVTILFSGI 427

  Fly   282 VGFTVLSSQCS----AQELVRLLNELFGRFDQLA---HDNHCLRIKILGDCYYCVSGLPEPRKDH 339
            |||....|:.:    |.::|.|||:::.|||.|.   ::.:..:::.:||.|..|||:|||...|
 Frog   428 VGFNTFCSKHASGEGAMKIVNLLNDIYTRFDILTDSRNNPYVYKVETVGDKYMTVSGIPEPCVHH 492

  Fly   340 AKCAVEMGLDMIDAIATVVEATDVILNMRVGIHTGRVLCGVLGLRKWQFDVWSNDVTLANHMESG 404
            |:....:.|||:: ||..|:.....:.:.:|||||.|:.||:|.|..::.::.|.|.|.:..|:.
 Frog   493 ARSICHLALDMME-IAGQVQVDGESVQITIGIHTGEVVTGVIGQRMPRYCLFGNTVNLTSRTETT 556

  Fly   405 GEPGRVHVTRAT 416
            ||.|:::|:..|
 Frog   557 GEKGKINVSEYT 568

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rutNP_511156.2 AC_N <17..255 CDD:292831 13/37 (35%)
CYCc 230..425 CDD:214485 68/194 (35%)
Guanylate_cyc 266..438 CDD:278633 55/158 (35%)
DUF1053 624..696 CDD:283888
SLC5-6-like_sbd <742..>893 CDD:294310
CYCc 924..1134 CDD:214485
Guanylate_cyc 954..1151 CDD:278633
gucy1b1XP_004911214.1 HNOB 2..166 CDD:377902
HNOBA 207..406 CDD:369471 13/33 (39%)
Guanylate_cyc 412..605 CDD:306677 56/165 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.