Sequence 1: | NP_511156.2 | Gene: | rut / 32406 | FlyBaseID: | FBgn0003301 | Length: | 2248 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_004911214.1 | Gene: | gucy1b1 / 100379900 | XenbaseID: | XB-GENE-950986 | Length: | 618 | Species: | Xenopus tropicalis |
Alignment Length: | 207 | Identity: | 70/207 - (33%) |
---|---|---|---|
Similarity: | 121/207 - (58%) | Gaps: | 22/207 - (10%) |
- Green bases have known domain annotations that are detailed below.
Fly 222 IASRLE-----IQDENEKLERLLLSVLPQHVAMQMKNDILSPVAGQFHRIYIQKHENVSILFADI 281
Fly 282 VGFTVLSSQCS----AQELVRLLNELFGRFDQLA---HDNHCLRIKILGDCYYCVSGLPEPRKDH 339
Fly 340 AKCAVEMGLDMIDAIATVVEATDVILNMRVGIHTGRVLCGVLGLRKWQFDVWSNDVTLANHMESG 404
Fly 405 GEPGRVHVTRAT 416 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
rut | NP_511156.2 | AC_N | <17..255 | CDD:292831 | 13/37 (35%) |
CYCc | 230..425 | CDD:214485 | 68/194 (35%) | ||
Guanylate_cyc | 266..438 | CDD:278633 | 55/158 (35%) | ||
DUF1053 | 624..696 | CDD:283888 | |||
SLC5-6-like_sbd | <742..>893 | CDD:294310 | |||
CYCc | 924..1134 | CDD:214485 | |||
Guanylate_cyc | 954..1151 | CDD:278633 | |||
gucy1b1 | XP_004911214.1 | HNOB | 2..166 | CDD:377902 | |
HNOBA | 207..406 | CDD:369471 | 13/33 (39%) | ||
Guanylate_cyc | 412..605 | CDD:306677 | 56/165 (34%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |