DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5347 and AT1G04990

DIOPT Version :9

Sequence 1:NP_572970.1 Gene:CG5347 / 32403 FlyBaseID:FBgn0030578 Length:285 Species:Drosophila melanogaster
Sequence 2:NP_001318923.1 Gene:AT1G04990 / 839351 AraportID:AT1G04990 Length:404 Species:Arabidopsis thaliana


Alignment Length:323 Identity:60/323 - (18%)
Similarity:95/323 - (29%) Gaps:141/323 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 RRSQTICRFHL-LGICRFGDLCRFSHDETTPNDNQSPQISEIADEVVENEQVVASTSSYSRQMTW 67
            |..:..|:|:| .|:|.:|..||::|....|.|                      .:.|..::  
plant    47 RPGERDCQFYLRTGLCGYGSSCRYNHPTHLPQD----------------------VAYYKEEL-- 87

  Fly    68 ANAPEFVPRYKANSADFQATEGVQDICPY---GGSCIWGSKCSYPLHMEICKMCDLYCLHPMDQN 129
               ||.:              |..| |.|   .|:|.:|..|.|  |            ||.|:|
plant    88 ---PERI--------------GQPD-CEYFLKTGACKYGPTCKY--H------------HPKDRN 120

  Fly   130 QRRAHNRECLEQHEQAMELSFAI----ARSKDKMC------GICFDTVVEKKGRERRFGILSKCK 184
                          .|..:.|.:    .|..:|.|      |.|            |||:..|..
plant   121 --------------GAQPVMFNVIGLPMRLGEKPCPYYLRTGTC------------RFGVACKFH 159

  Fly   185 H-----------------------IFCLTCIRTW-----RQAHQFEATV----TRGCPECRVFSE 217
            |                       ...||.:.|:     .|..|....:    ::|....:.::.
plant   160 HPQPDNGHSTAYGMSSFPAADLRYASGLTMMSTYGTLPRPQVPQSYVPILVSPSQGFLPPQGWAP 224

  Fly   218 FVCPSAYWVDTKEEKDKLLSEYRAAMGA------------KDCKYFNGGLGKCPFGNKCFYRH 268
            ::..|....:.|.:.....|....||..            .:|::|. ..|.|.:|:.|.|.|
plant   225 YMAASNSMYNVKNQPYYSGSSASMAMAVALNRGLSESSDQPECRFFM-NTGTCKYGDDCKYSH 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5347NP_572970.1 ZnF_C3H1 4..30 CDD:214632 10/26 (38%)
PHA03096 <80..239 CDD:222981 35/203 (17%)
RING 159..213 CDD:238093 14/91 (15%)
AT1G04990NP_001318923.1 zf-CCCH 48..73 CDD:395517 8/24 (33%)
zf-CCCH 92..117 CDD:395517 11/39 (28%)
zf-CCCH 137..162 CDD:395517 9/36 (25%)
YTH1 <261..403 CDD:227416 8/27 (30%)
zf-CCCH 263..287 CDD:395517 8/25 (32%)
zf-CCCH 308..334 CDD:395517
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.