DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5347 and AT1G24440

DIOPT Version :9

Sequence 1:NP_572970.1 Gene:CG5347 / 32403 FlyBaseID:FBgn0030578 Length:285 Species:Drosophila melanogaster
Sequence 2:NP_564218.1 Gene:AT1G24440 / 839060 AraportID:AT1G24440 Length:251 Species:Arabidopsis thaliana


Alignment Length:142 Identity:33/142 - (23%)
Similarity:52/142 - (36%) Gaps:36/142 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 LHMEICKMCDLYCLHPMDQNQRRAHNRECLEQHEQAMELS---FAIARSKDKMCGICFDTVVEKK 171
            ||:....:.|....:|         |.:.:.:.:..:|.|   .:|...::..||||.:...:. 
plant   111 LHINFADLPDESLWYP---------NPKAITKKQYDIEGSRYMNSIDLEREDECGICLEPCTKM- 165

  Fly   172 GRERRFGILSKCKHIFCLTCIRTWRQAHQFEATVTRGCPECRVFSEFVCPSAYWVDTKEE----- 231
                   :|..|.|..|:.|.|.|.       |.:..||.||...:.|.....||.|.:|     
plant   166 -------VLPNCCHAMCIKCYRNWN-------TKSESCPFCRGSIKRVNSEDLWVLTCDEDVVDP 216

  Fly   232 ----KDKLLSEY 239
                |:.||..|
plant   217 ETVTKEDLLRFY 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5347NP_572970.1 ZnF_C3H1 4..30 CDD:214632
PHA03096 <80..239 CDD:222981 32/140 (23%)
RING 159..213 CDD:238093 14/53 (26%)
AT1G24440NP_564218.1 RING_Ubox 155..193 CDD:418438 14/52 (27%)
RING-HC finger (C3HC4-type) 155..192 CDD:319361 14/51 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1039
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.