DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5347 and AT1G13195

DIOPT Version :9

Sequence 1:NP_572970.1 Gene:CG5347 / 32403 FlyBaseID:FBgn0030578 Length:285 Species:Drosophila melanogaster
Sequence 2:NP_563922.1 Gene:AT1G13195 / 837878 AraportID:AT1G13195 Length:260 Species:Arabidopsis thaliana


Alignment Length:237 Identity:43/237 - (18%)
Similarity:73/237 - (30%) Gaps:87/237 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 NEQVVASTSSYSRQMTWANAPEFVPRYKANSADFQATEGVQDICPYGGSCI-------------- 101
            |:..::|:||.|         .:....|...||.|....:.:..|.|.:.:              
plant     3 NQLAISSSSSSS---------SYYESLKVLEADVQHANSLAEAIPMGKNNVRLQMKLVHSNFASL 58

  Fly   102 ------W---GSKCSYPLHMEICKMCDLYCLHPMDQNQRRAHNREC------------------- 138
                  |   .|.|..|.::.:..:. :|.:....|.:...|.|:.                   
plant    59 LLFLLRWIDLSSSCLIPRYLNLFHVL-VYKVQSDGQPKLTTHGRKATISEFYGVILPSLQLLHSN 122

  Fly   139 LEQHEQAMELSFAIAR-------------------SKDKMCGICFDTVVEKKGRERRFGILSKCK 184
            |::.| ..::.|.:.|                   .:::.||||.:|..:.        :|..|.
plant   123 LDELE-TTDIGFDLKRLSKKITKEARSSRFSNAGLEREEECGICLETCTKM--------VLPNCC 178

  Fly   185 HIFCLTCIRTWRQAHQFEATVTRGCPECRVFSEFVCPSAYWV 226
            |..|:.|.|.|....|       .||.||...:.|.....||
plant   179 HSMCIKCYRNWNLKSQ-------SCPFCRGSMKRVNSEDLWV 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5347NP_572970.1 ZnF_C3H1 4..30 CDD:214632
PHA03096 <80..239 CDD:222981 37/208 (18%)
RING 159..213 CDD:238093 15/53 (28%)
AT1G13195NP_563922.1 COG5540 <98..200 CDD:227827 21/117 (18%)
RING_Ubox 161..200 CDD:418438 15/53 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1039
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.