DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG5347 and Trim3

DIOPT Version :9

Sequence 1:	NP_572970.1	Gene:	CG5347 / 32403	FlyBaseID:	FBgn0030578	Length:	285	Species:	Drosophila melanogaster
Sequence 2:	XP_038948510.1	Gene:	Trim3 / 83616	RGDID:	70074	Length:	750	Species:	Rattus norvegicus

Alignment Length:	70	Identity:	20/70 - (28%)
Similarity:	28/70 - (40%)	Gaps:	19/70 - (27%)

- Green bases have known domain annotations that are detailed below.

  Fly   144 QAMELSFAIARSKDKMCGICFDTVVEKKGRERRFGILSKCKHIFCLTCIRTWRQAHQFEATVTRG 208
            |.|:..|.:       |.||.|       |.|...:| .|.|.||..|::.:....    ::|..
  Rat    13 QPMDKQFLV-------CSICLD-------RYRCPKVL-PCLHTFCERCLQNYIPPQ----SLTLS 58

  Fly   209 CPECR 213
            ||.||
  Rat    59 CPVCR 63

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG5347	NP_572970.1	ZnF_C3H1	4..30	CDD:214632
		PHA03096	<80..239	CDD:222981	20/70 (29%)
		RING	159..213	CDD:238093	15/53 (28%)
Trim3	XP_038948510.1	RING-HC_TRIM3	19..63	CDD:319682	16/62 (26%)
		Bbox_SF	107..159	CDD:412124
		BBC	164..290	CDD:128778
		IG_FLMN	328..425	CDD:214720
		NHL_TRIM2_like	477..750	CDD:271330
		NHL repeat	495..534	CDD:271330
		NHL repeat	542..581	CDD:271330
		NHL repeat	584..620	CDD:271330
		NHL repeat	628..668	CDD:271330
		NHL repeat	677..717	CDD:271330
		NHL repeat	720..746	CDD:271330
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910