DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5347 and AT5G18550

DIOPT Version :9

Sequence 1:NP_572970.1 Gene:CG5347 / 32403 FlyBaseID:FBgn0030578 Length:285 Species:Drosophila melanogaster
Sequence 2:NP_197356.2 Gene:AT5G18550 / 831973 AraportID:AT5G18550 Length:465 Species:Arabidopsis thaliana


Alignment Length:323 Identity:56/323 - (17%)
Similarity:101/323 - (31%) Gaps:106/323 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 RRSQTICRFHL-LGICRFGDLCRFSHDETTPNDNQSPQISEIADEVVENEQVV------------ 55
            |..:..|.::| .|:|.:|..|||:|..     |::|.:..:..|..|..:.:            
plant    51 RPDEPDCIYYLRTGVCGYGSRCRFNHPR-----NRAPVLGGLRTEAGEFPERMGQPVCQHFMRTG 110

  Fly    56 ----ASTSSYSRQMTWANAPEFVPRYKANSADFQATEGVQDICPY---GGSCIWGSKCSYPLHME 113
                .::..|.............| ...|...|....|.:: |.|   .|.|.:||.|.|  |  
plant   111 TCKFGASCKYHHPRQGGGGDSVTP-VSLNYMGFPLRPGEKE-CSYFMRTGQCKFGSTCRY--H-- 169

  Fly   114 ICKMCDLYCLHPMDQNQRRAHNRECLEQHEQAMELSFAIARSKDKMCGICFDTVVEKKGRERRFG 178
                      ||:....:....::  :|...|....:...:|:         ||..    .:::|
plant   170 ----------HPVPPGVQAPSQQQ--QQQLSAGPTMYPSLQSQ---------TVPS----SQQYG 209

  Fly   179 ILSKCKHIFCLTCIRT------------------WRQAHQFEATV-------------------- 205
            ::.....:...:.:::                  |   :.::|:|                    
plant   210 VVLARPQLLPGSYVQSPYGYGQMVLPPGMVPYSGW---NPYQASVSAMPSPGTQPSMGTSSVYGI 271

  Fly   206 TRGCPECRVFSEFVCPSAYWVDTKEEKDKLLSEYRAAMGAKDCKYFNGGLGKCPFGNKCFYRH 268
            |...|....:..  .||:..|..||:......|      ..:|:||. ..|.|.||..|.:.|
plant   272 TPLSPSAPAYQS--GPSSTGVSNKEQTFPQRPE------QPECQYFM-RTGDCKFGTSCRFHH 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5347NP_572970.1 ZnF_C3H1 4..30 CDD:214632 10/26 (38%)
PHA03096 <80..239 CDD:222981 30/199 (15%)
RING 159..213 CDD:238093 8/91 (9%)
AT5G18550NP_197356.2 zf-CCCH 52..78 CDD:395517 9/25 (36%)
zf-CCCH 99..124 CDD:395517 1/24 (4%)
zf-CCCH 146..172 CDD:395517 11/40 (28%)
zf-CCCH 301..327 CDD:395517 10/32 (31%)
zf-CCCH 346..370 CDD:395517
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.