DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5347 and AIRP2

DIOPT Version :9

Sequence 1:NP_572970.1 Gene:CG5347 / 32403 FlyBaseID:FBgn0030578 Length:285 Species:Drosophila melanogaster
Sequence 2:NP_195772.1 Gene:AIRP2 / 831747 AraportID:AT5G01520 Length:242 Species:Arabidopsis thaliana


Alignment Length:136 Identity:32/136 - (23%)
Similarity:46/136 - (33%) Gaps:46/136 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 EICKMCDLYCLHPMDQNQRRAHNRECLEQHEQAMELSFAIARSKDKMCGICFDTVVEKKGRERRF 177
            |||           |:..|:....:..:..|..:|        :::.||||.:.        |..
plant   118 EIC-----------DKRYRKKDRTDKGKMSEIDLE--------REEECGICLEI--------RNK 155

  Fly   178 GILSKCKHIFCLTCIRTWRQAHQFEATVTRGCPECRVFSEFVCPSAYWVDT------------KE 230
            .:|..|.|..|:.|.|.||...|       .||.||...:.|.....|:.|            ||
plant   156 VVLPTCNHSMCINCYRNWRARSQ-------SCPFCRGSLKRVNSGDLWIYTCSAEIADLPAIYKE 213

  Fly   231 EKDKLL 236
            ...:||
plant   214 NLKRLL 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5347NP_572970.1 ZnF_C3H1 4..30 CDD:214632
PHA03096 <80..239 CDD:222981 32/136 (24%)
RING 159..213 CDD:238093 16/53 (30%)
AIRP2NP_195772.1 zf-rbx1 <146..238 CDD:331150 25/89 (28%)
RING_Ubox 146..184 CDD:327409 16/52 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1039
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.