DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5347 and HUA1

DIOPT Version :9

Sequence 1:NP_572970.1 Gene:CG5347 / 32403 FlyBaseID:FBgn0030578 Length:285 Species:Drosophila melanogaster
Sequence 2:NP_187874.2 Gene:HUA1 / 820448 AraportID:AT3G12680 Length:524 Species:Arabidopsis thaliana


Alignment Length:271 Identity:59/271 - (21%)
Similarity:90/271 - (33%) Gaps:99/271 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 RRSQTICRFHL-LGICRFGDLCRFSHDETTPNDNQSPQISEIADEVVENEQVVASTSSYSRQMTW 67
            |.|:.:|.|:: .|.|:||..|:|.|    |.|.|.|..|          |.:.|:...:.:...
plant   268 RPSEPMCTFYMKTGKCKFGLSCKFHH----PKDIQLPSSS----------QDIGSSVGLTSEPDA 318

  Fly    68 ANAPE--FVPRYKANSADFQATEGVQDICPY---GGSCIWGSKCSYPLHMEICKMCDLYCLHPMD 127
            .|.|.  |.|....||.......|..| ||:   .|||.:|:.|.|.              ||  
plant   319 TNNPHVTFTPALYHNSKGLPVRSGEVD-CPFYLKTGSCKYGATCRYN--------------HP-- 366

  Fly   128 QNQRRAHNRECLEQHEQAMELSFAIARSKDKMCGICFDTVVEKKGRERRFGILSKCKHIFCLTCI 192
              :|.|.       ..||..:::::..|......:               |:::           
plant   367 --ERTAF-------IPQAAGVNYSLVSSNTANLNL---------------GLVT----------- 396

  Fly   193 RTWRQAHQFEATVTRGCPECRVFSEFVCPSAYWVDTKEEKDKLLSEYRAAMGAKDCKYFNGGLGK 257
                .|..|..|:|:  |...|.|                    :.|....|..:|.|:. ..|:
plant   397 ----PATSFYQTLTQ--PTLGVIS--------------------ATYPQRPGQSECDYYM-KTGE 434

  Fly   258 CPFGNKCFYRH 268
            |.||.:|.:.|
plant   435 CKFGERCKFHH 445

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5347NP_572970.1 ZnF_C3H1 4..30 CDD:214632 11/26 (42%)
PHA03096 <80..239 CDD:222981 27/161 (17%)
RING 159..213 CDD:238093 6/53 (11%)
HUA1NP_187874.2 zf-CCCH 342..367 CDD:395517 12/43 (28%)
zf-CCCH 421..446 CDD:395517 9/26 (35%)
zf-CCCH 478..500 CDD:395517
zf-CCCH 176..200 CDD:395517
zf-CCCH 226..252 CDD:395517
zf-CCCH 274..295 CDD:395517 9/24 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.