DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5347 and AT3G08505

DIOPT Version :9

Sequence 1:NP_572970.1 Gene:CG5347 / 32403 FlyBaseID:FBgn0030578 Length:285 Species:Drosophila melanogaster
Sequence 2:NP_001325802.1 Gene:AT3G08505 / 819998 AraportID:AT3G08505 Length:323 Species:Arabidopsis thaliana


Alignment Length:283 Identity:91/283 - (32%)
Similarity:141/283 - (49%) Gaps:28/283 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 ICRFHLLGICRFGDLCRFSHDETTPNDNQSPQISEIA---------DEVVENEQVVASTSSYSRQ 64
            :|:|.:.|.|..|:.|.||||...|.:|......:..         |.|.....:..|:.|.|..
plant     6 LCKFFVHGSCLKGENCEFSHDSKDPPNNVCTFYQKRICLYGSRCRYDHVRAASNLPLSSDSESLD 70

  Fly    65 MTWANAPEFVPRYKANSADFQATEGV-------QDICPY--GGSCIWGSKCSYPLHMEICKMCDL 120
            .:.:..|....:.:.::.|...:..|       ..||.:  .|.|..|::|.: :|.::|..|..
plant    71 RSISTTPSRHLQQQGDNNDGDKSSNVYCIHPREYPICSFAAAGDCPRGNQCPH-MHGDLCNTCGK 134

  Fly   121 YCLHPMDQNQRRAHNRECLEQHEQAMELSFAIARSKDKMCGICFDTVVEK-KGRERRFGILSKCK 184
            .||||....:|..|.:|| |:.::.:|   |:.:|:|..|.:|.|.::.| ...||:||:|::|.
plant   135 KCLHPFRPEEREEHTKEC-EKKQKHIE---ALKQSQDIECSVCLDRILSKATPGERKFGLLTECD 195

  Fly   185 HIFCLTCIRTWRQAHQFEA----TVTRGCPECRVFSEFVCPSAYWVDTKEEKDKLLSEYRAAMGA 245
            |.||:.|||.||.:.....    :..|.||.||..|.||.||..|..:.|||.:::..|:|.:.:
plant   196 HPFCIQCIRNWRSSAPVSGMDVNSTLRACPICRKLSYFVVPSVVWYSSPEEKKEIIDIYKAKLRS 260

  Fly   246 KDCKYFNGGLGKCPFGNKCFYRH 268
            .|||:||.|.|.||||..|||:|
plant   261 IDCKHFNFGNGNCPFGASCFYKH 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5347NP_572970.1 ZnF_C3H1 4..30 CDD:214632 9/20 (45%)
PHA03096 <80..239 CDD:222981 56/172 (33%)
RING 159..213 CDD:238093 21/58 (36%)
AT3G08505NP_001325802.1 YTH1 <5..>120 CDD:227416 25/113 (22%)
PHA03096 <115..268 CDD:222981 57/157 (36%)
RING-HC_MKRN 170..228 CDD:319435 21/57 (37%)
RING-HC finger (C3HC4-type) 170..227 CDD:319435 21/56 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 57 1.000 Domainoid score I3992
eggNOG 1 0.900 - - E1_KOG1039
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 171 1.000 Inparanoid score I1531
OMA 1 1.010 - - QHG58455
OrthoDB 1 1.010 - - D1388677at2759
OrthoFinder 1 1.000 - - FOG0000752
OrthoInspector 1 1.000 - - mtm1123
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11224
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X837
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.940

Return to query results.
Submit another query.