DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5347 and MKRN3

DIOPT Version :9

Sequence 1:NP_572970.1 Gene:CG5347 / 32403 FlyBaseID:FBgn0030578 Length:285 Species:Drosophila melanogaster
Sequence 2:NP_005655.1 Gene:MKRN3 / 7681 HGNCID:7114 Length:507 Species:Homo sapiens


Alignment Length:325 Identity:131/325 - (40%)
Similarity:170/325 - (52%) Gaps:65/325 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 QTICRFHLLGICRFGDLCRFSHD----ETTPNDNQSP-------------QISEIADEVVENEQV 54
            |.|||:::.|.|:.|:.||:|||    :.......||             .|.....||.|....
Human    98 QIICRYYIHGQCKEGENCRYSHDLSGRKMATEGGVSPPGASAGGGPSTAAHIEPPTQEVAEAPPA 162

  Fly    55 VASTS-----SYSRQ--------------------MTWANAPEFVP------RYKANS--ADFQA 86
            .:|.|     |.:.:                    .:||:|.||||      |:.|::  |..|:
Human   163 ASSLSLPVIGSAAERGFFEAERDNADRGAAGGAGVESWADAIEFVPGQPYRGRWVASAPEAPLQS 227

  Fly    87 TE----------GVQDICPYG--GSCIWGSKCSYPLHMEICKMCDLYCLHPMDQNQRRAHNRECL 139
            :|          |:: .|.|.  |.|..|..|.| ||.:||.||.|..|||||..||..|.|.|:
Human   228 SETERKQMAVGSGLR-FCYYASRGVCFRGESCMY-LHGDICDMCGLQTLHPMDAAQREEHMRACI 290

  Fly   140 EQHEQAMELSFAIARSKDKMCGICFDTVVEKKG-RERRFGILSKCKHIFCLTCIRTWRQAHQFEA 203
            |.||:.||||||:.|..||:||||.:.|.||.. .:|||||||.|.|.||:.|||.||.|.|||.
Human   291 EAHEKDMELSFAVQRGMDKVCGICMEVVYEKANPNDRRFGILSNCNHSFCIRCIRRWRSARQFEN 355

  Fly   204 TVTRGCPECRVFSEFVCPSAYWVDTKEEKDKLLSEYRAAMGAKDCKYFNGGLGKCPFGNKCFYRH 268
            .:.:.||:|||.||.|.||.:||:.:|||.||:.:|:.||..|.|:||..|.|.||||:.|||:|
Human   356 RIVKSCPQCRVTSELVIPSEFWVEEEEEKQKLIQQYKEAMSNKACRYFAEGRGNCPFGDTCFYKH 420

  Fly   269  268
            Human   421  420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5347NP_572970.1 ZnF_C3H1 4..30 CDD:214632 12/26 (46%)
PHA03096 <80..239 CDD:222981 84/173 (49%)
RING 159..213 CDD:238093 29/54 (54%)
MKRN3NP_005655.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..48
DNA_pol3_gamma3 <33..232 CDD:331207 33/133 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 69..89
ZnF_C3H1 95..121 CDD:214632 11/22 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 126..149 2/22 (9%)
PHA02929 <252..400 CDD:331986 81/148 (55%)
Makorin-type Cys-His 266..293 15/26 (58%)
RING-HC_MKRN1_3 308..368 CDD:319644 34/59 (58%)
RING-HC finger (C3HC4-type) 311..364 CDD:319644 29/52 (56%)
MKRN1_C 439..505 CDD:318109
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 85 0.172 Domainoid score I8156
eggNOG 1 0.900 - - E1_KOG1039
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 252 1.000 Inparanoid score I3221
Isobase 1 0.950 - 0 Normalized mean entropy S3270
OMA 1 1.010 - - QHG58455
OrthoDB 1 1.010 - - D1388677at2759
OrthoFinder 1 1.000 - - FOG0000752
OrthoInspector 1 1.000 - - mtm8603
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11224
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X837
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1312.890

Return to query results.
Submit another query.