DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5347 and mkrn4

DIOPT Version :9

Sequence 1:NP_572970.1 Gene:CG5347 / 32403 FlyBaseID:FBgn0030578 Length:285 Species:Drosophila melanogaster
Sequence 2:XP_005167100.1 Gene:mkrn4 / 559882 ZFINID:ZDB-GENE-030131-5954 Length:402 Species:Danio rerio


Alignment Length:319 Identity:90/319 - (28%)
Similarity:134/319 - (42%) Gaps:65/319 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 QTICRFHLLGICRFGDLCRFSHDETTPNDNQSPQISE---IADEVVENEQVVASTSSYSRQMTWA 68
            |..||:...|.|.|||.||:.|   ||.:.:...:|.   .|..|..:  .|.|.|...|:   .
Zfish    50 QVQCRYFQKGGCWFGDRCRYLH---TPQNGEGSSVSSRRGSAPAVFPS--AVGSRSLSDRR---G 106

  Fly    69 NAPEFVPR--YKANS------------------------ADFQATEGVQDI-CPYGGS-CIWGSK 105
            :.|..:|:  |..|.                        |:.:.:..|:|: ...|.| .::.|.
Zfish   107 SEPSLLPQGAYSMNRRGSEPLVTSMSALQRNFERLTTGIAEEEESGVVEDVPLQLGASRTLYQSN 171

  Fly   106 CSY---------------PLHMEICKMCDLYCLHPMDQNQRRAHNRECLEQHEQAMELSFAIARS 155
            .::               |..:|..|:........:.::..|  :.:.........:.|.|..:|
Zfish   172 ATHSSSSHNYTSTSFMAAPAPVEATKITVAEAETQVTKSPVR--SGQVAAAVSSVQQCSGAFDQS 234

  Fly   156 KDKMCGICFDTVVEKK-GRERRFGILSKCKHIFCLTCIRTWRQAHQFEATVTRGCPECRVFSEFV 219
            .|..||||.|.:.||. .:|||:|||..|.|.||:.||.|||:...|:..|.:|||:|||.|.|.
Zfish   235 NDVACGICMDKISEKSTAQERRYGILPNCNHAFCIGCIVTWRKTKDFQEEVIKGCPQCRVKSSFY 299

  Fly   220 CPSAYWVDTKEEKDKLLSEYRAAMGAKDCKYFNGGLGKCPFGNKCFYRH-------HRR 271
            .||.:||...|||..|::.::.......|.:|... |.|||.::|.|.|       |||
Zfish   300 IPSKHWVCDGEEKASLIASFKERSSKLKCTFFMRH-GCCPFKSECIYSHDMPVNHTHRR 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5347NP_572970.1 ZnF_C3H1 4..30 CDD:214632 11/22 (50%)
PHA03096 <80..239 CDD:222981 55/200 (28%)
RING 159..213 CDD:238093 27/54 (50%)
mkrn4XP_005167100.1 ZnF_C3H1 <53..73 CDD:214632 10/22 (45%)
RING 239..293 CDD:238093 27/53 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170580291
Domainoid 1 1.000 79 1.000 Domainoid score I8592
eggNOG 1 0.900 - - E1_KOG1039
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1388677at2759
OrthoFinder 1 1.000 - - FOG0000752
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11224
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
98.810

Return to query results.
Submit another query.