DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG5347 and trim2

DIOPT Version :9

Sequence 1:	NP_572970.1	Gene:	CG5347 / 32403	FlyBaseID:	FBgn0030578	Length:	285	Species:	Drosophila melanogaster
Sequence 2:	NP_001005680.1	Gene:	trim2 / 448181	XenbaseID:	XB-GENE-942459	Length:	760	Species:	Xenopus tropicalis

Alignment Length:	65	Identity:	20/65 - (30%)
Similarity:	28/65 - (43%)	Gaps:	15/65 - (23%)

- Green bases have known domain annotations that are detailed below.

  Fly   152 IARSKDK---MCGICFDTVVEKKGRERRFGILSKCKHIFCLTCIRTWRQAHQFEATVTRGCPECR 213
            :.|..||   :|.||.|.....|        :..|.|.||..|::.:..||    ::|..||.||
Frog    12 VVRQIDKQFLICSICLDRYKNPK--------VLPCLHTFCERCLQNYIPAH----SLTLSCPVCR 64

Fly 214 213
Frog 65 64

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG5347	NP_572970.1	ZnF_C3H1	4..30	CDD:214632
		PHA03096	<80..239	CDD:222981	20/65 (31%)
		RING	159..213	CDD:238093	15/53 (28%)
trim2	NP_001005680.1	RING	23..66	CDD:238093	17/54 (31%)
		BBOX	113..154	CDD:197662
		BBC	161..287	CDD:128778
		IG_FLMN	325..421	CDD:214720
		Filamin	325..418	CDD:279024
		NHL_TRIM2_like	483..760	CDD:271330
		NHL repeat	501..540	CDD:271330
		YncE	547..>751	CDD:225926
		NHL repeat	548..587	CDD:271330
		NHL repeat	590..627	CDD:271330
		NHL repeat	634..679	CDD:271330
		NHL repeat	685..727	CDD:271330
		NHL repeat	730..756	CDD:271330
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910