powered by:
Protein Alignment CG5347 and trim2
DIOPT Version :9
Sequence 1: | NP_572970.1 |
Gene: | CG5347 / 32403 |
FlyBaseID: | FBgn0030578 |
Length: | 285 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001005680.1 |
Gene: | trim2 / 448181 |
XenbaseID: | XB-GENE-942459 |
Length: | 760 |
Species: | Xenopus tropicalis |
Alignment Length: | 65 |
Identity: | 20/65 - (30%) |
Similarity: | 28/65 - (43%) |
Gaps: | 15/65 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 152 IARSKDK---MCGICFDTVVEKKGRERRFGILSKCKHIFCLTCIRTWRQAHQFEATVTRGCPECR 213
:.|..|| :|.||.|.....| :..|.|.||..|::.:..|| ::|..||.||
Frog 12 VVRQIDKQFLICSICLDRYKNPK--------VLPCLHTFCERCLQNYIPAH----SLTLSCPVCR 64
Fly 214 213
Frog 65 64
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.