DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5347 and Mkrn1

DIOPT Version :9

Sequence 1:NP_572970.1 Gene:CG5347 / 32403 FlyBaseID:FBgn0030578 Length:285 Species:Drosophila melanogaster
Sequence 2:NP_001246867.1 Gene:Mkrn1 / 44131 FlyBaseID:FBgn0029152 Length:386 Species:Drosophila melanogaster


Alignment Length:313 Identity:178/313 - (56%)
Similarity:215/313 - (68%) Gaps:49/313 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSYRRSQTICRFHLLGICRFGDLCRFSHDETTPNDNQSPQISE-IADEVVENEQVVAST------ 58
            |:..|||||||:::.||||||:|||||||.:    ...|:..| :|.:|:......:|:      
  Fly    14 MALGRSQTICRYYVRGICRFGELCRFSHDLS----RGRPECEEQVATDVLPKPSTSSSSTIGSRS 74

  Fly    59 -SSYSRQMTWANAPEFVP---RYKAN-SADFQAT---EGVQD---------ICP----------- 95
             |..|:|..|||||.|||   ||.|: .::|:.|   |.|.:         :.|           
  Fly    75 ASISSQQRNWANAPVFVPSQKRYTAHEQSEFETTVDPEAVMEAQAGASYDTLAPGVSWAEVVGGP 139

  Fly    96 -------YG---GSCIWGSKCSYPLHMEICKMCDLYCLHPMDQNQRRAHNRECLEQHEQAMELSF 150
                   ||   .||.||...:||:|||:|:|||.|||||.||.|||:||||||:||||||||||
  Fly   140 SSLNKEDYGEENSSCAWGEFSAYPIHMELCEMCDQYCLHPTDQVQRRSHNRECLQQHEQAMELSF 204

  Fly   151 AIARSKDKMCGICFDTVVEKKGRERRFGILSKCKHIFCLTCIRTWRQAHQFEATVTRGCPECRVF 215
            ||||||||.|||||||::||.|||:|||||..|.|||||.||||||||.|||..:||.||||||.
  Fly   205 AIARSKDKTCGICFDTIMEKAGREKRFGILPNCNHIFCLECIRTWRQAKQFENKITRACPECRVC 269

  Fly   216 SEFVCPSAYWVDTKEEKDKLLSEYRAAMGAKDCKYFNGGLGKCPFGNKCFYRH 268
            |:||||||:|::|||||||||::||||:||||||||..|.|||||||||||:|
  Fly   270 SDFVCPSAFWMETKEEKDKLLNDYRAALGAKDCKYFKKGEGKCPFGNKCFYKH 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5347NP_572970.1 ZnF_C3H1 4..30 CDD:214632 19/25 (76%)
PHA03096 <80..239 CDD:222981 113/192 (59%)
RING 159..213 CDD:238093 39/53 (74%)
Mkrn1NP_001246867.1 ZnF_C3H1 20..43 CDD:214632 17/22 (77%)
RING 213..267 CDD:238093 39/53 (74%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448399
Domainoid 1 1.000 57 1.000 Domainoid score I3992
eggNOG 1 0.900 - - E1_KOG1039
Homologene 1 1.000 - - H32175
Inparanoid 1 1.050 171 1.000 Inparanoid score I1531
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D116581at6656
OrthoFinder 1 1.000 - - FOG0000752
OrthoInspector 1 1.000 - - mtm6616
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11224
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X837
1110.900

Return to query results.
Submit another query.