DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5347 and CG12477

DIOPT Version :9

Sequence 1:NP_572970.1 Gene:CG5347 / 32403 FlyBaseID:FBgn0030578 Length:285 Species:Drosophila melanogaster
Sequence 2:NP_649055.1 Gene:CG12477 / 40040 FlyBaseID:FBgn0036809 Length:265 Species:Drosophila melanogaster


Alignment Length:230 Identity:97/230 - (42%)
Similarity:124/230 - (53%) Gaps:34/230 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 VVENEQ-------VVASTSSYSRQMTWANAPEFVPRYKANSADFQATEGVQDICPYGGSC--IWG 103
            |..|:|       .|.||:|.|.|:........||.|||      ||.|.|.....|.:|  :..
  Fly     4 VASNDQHVDTGVLPVPSTNSPSSQIEQKGNEAIVPNYKA------ATAGEQGEAQAGATCTTVAV 62

  Fly   104 SKCSYPLHMEICKMCDLYCLHPMDQNQRRAHNRECLEQHEQAMELSFAIARSKDKMCGICFDTVV 168
            .........:|.|                  ....:..|.|....| :.|||:||.|||||:|::
  Fly    63 RPSGVATSADIVK------------------GSSSVSSHVQPSWRS-SFARSQDKKCGICFETIM 108

  Fly   169 EKKGRERRFGILSKCKHIFCLTCIRTWRQAHQFEATVTRGCPECRVFSEFVCPSAYWVDTKEEKD 233
            ||:|.::|||||..|.|:||..||.|||.|.|:...|||.||||||:|.||||||:||:.|..||
  Fly   109 EKEGGDKRFGILPSCNHVFCFQCICTWRHATQYAYQVTRACPECRVWSNFVCPSAFWVEEKVAKD 173

  Fly   234 KLLSEYRAAMGAKDCKYFNGGLGKCPFGNKCFYRH 268
            :|::::.|||.|:|||||..|.|.|.|||||||:|
  Fly   174 QLINDHLAAMRARDCKYFKQGQGVCLFGNKCFYKH 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5347NP_572970.1 ZnF_C3H1 4..30 CDD:214632
PHA03096 <80..239 CDD:222981 63/160 (39%)
RING 159..213 CDD:238093 31/53 (58%)
CG12477NP_649055.1 RING 99..153 CDD:238093 31/53 (58%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448400
Domainoid 1 1.000 57 1.000 Domainoid score I3992
eggNOG 1 0.900 - - E1_KOG1039
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 171 1.000 Inparanoid score I1531
Isobase 1 0.950 - 0 Normalized mean entropy S3270
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D116581at6656
OrthoFinder 1 1.000 - - FOG0000752
OrthoInspector 1 1.000 - - mtm1123
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11224
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
109.850

Return to query results.
Submit another query.