DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5347 and AgaP_AGAP000736

DIOPT Version :9

Sequence 1:NP_572970.1 Gene:CG5347 / 32403 FlyBaseID:FBgn0030578 Length:285 Species:Drosophila melanogaster
Sequence 2:XP_559376.4 Gene:AgaP_AGAP000736 / 3289739 VectorBaseID:AGAP000736 Length:328 Species:Anopheles gambiae


Alignment Length:196 Identity:42/196 - (21%)
Similarity:60/196 - (30%) Gaps:80/196 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 VENEQVVASTSSYSRQMTWANA---PEFVPRYKANSA--------------DFQATEGVQDICPY 96
            ||::::.:..:|.||..|.::|   |:..|..|.:.|              :..|........|.
Mosquito   125 VESQRIHSPGASPSRSSTGSSATGPPDTPPSAKVDGAGPSAAAAGAARPPPESPARTATPTTVPL 189

  Fly    97 GGSCIWGSKCS--------YP-------LHMEICKMCDLYCLHPMDQNQRRAHNRECLEQHEQAM 146
            ..|   .|.||        :|       |..::    |.....|.|...   |..||        
Mosquito   190 SSS---ASTCSSSGGGTFVFPDCTTASILMAQV----DAIAAGPADATD---HADEC-------- 236

  Fly   147 ELSFAIARSKDKMCGICFDTVVEKKGRERRFGILSKCKHIFCLTCIRTWRQAHQFEATVTRGCPE 211
                         | ||.         |||..:...|.|.:|:.||..| ..||      :.||.
Mosquito   237 -------------C-ICL---------ERRPEVSLPCAHSYCMPCIEQW-NIHQ------KTCPI 271

  Fly   212 C 212
            |
Mosquito   272 C 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5347NP_572970.1 ZnF_C3H1 4..30 CDD:214632
PHA03096 <80..239 CDD:222981 32/162 (20%)
RING 159..213 CDD:238093 17/54 (31%)
AgaP_AGAP000736XP_559376.4 zf-RING_2 234..272 CDD:290367 18/75 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1039
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.