DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5347 and rnf141

DIOPT Version :9

Sequence 1:NP_572970.1 Gene:CG5347 / 32403 FlyBaseID:FBgn0030578 Length:285 Species:Drosophila melanogaster
Sequence 2:NP_001001800.1 Gene:rnf141 / 308900 RGDID:1303154 Length:230 Species:Rattus norvegicus


Alignment Length:79 Identity:23/79 - (29%)
Similarity:30/79 - (37%) Gaps:20/79 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   157 DKMCGICFDTVVEKKGRERRFGILSKCKHIFCLTCIRTWRQAHQFEATVTRGCPECRVFSEFVCP 221
            ::.|.||.|         .|..::..|.|.||..||..|...|       |.||.||:  :....
  Rat   152 EEECCICMD---------GRADLILPCAHSFCQKCIDKWSDRH-------RNCPICRL--QMTGA 198

  Fly   222 SAYWV--DTKEEKD 233
            :..||  |...|.|
  Rat   199 NESWVVSDAPTEDD 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5347NP_572970.1 ZnF_C3H1 4..30 CDD:214632
PHA03096 <80..239 CDD:222981 23/79 (29%)
RING 159..213 CDD:238093 16/53 (30%)
rnf141NP_001001800.1 rad18 129..>207 CDD:273165 20/72 (28%)
RING-HC_RNF141 154..192 CDD:319459 16/53 (30%)
RING-HC finger (C3HC4-type) 155..191 CDD:319459 16/51 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1039
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.