DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5347 and Mkrn2

DIOPT Version :9

Sequence 1:NP_572970.1 Gene:CG5347 / 32403 FlyBaseID:FBgn0030578 Length:285 Species:Drosophila melanogaster
Sequence 2:NP_001008315.1 Gene:Mkrn2 / 297525 RGDID:1310618 Length:417 Species:Rattus norvegicus


Alignment Length:322 Identity:119/322 - (36%)
Similarity:164/322 - (50%) Gaps:63/322 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RSQTICRFHLLGICRFGDLCRFSHDE--------TTPNDNQSPQ--------ISEIADEVV---- 49
            :..|||:::..|.|.:|..||:.|.:        ..|..:.||.        .|:||..|:    
  Rat    32 KPSTICKYYQKGYCAYGARCRYDHTKPPAAAGGAVGPAPHPSPSSGLHSPHPSSDIATSVMRTHS 96

  Fly    50 ------ENEQVVASTSSYSRQMT-----------------WANAPEFVPRYKANS---------A 82
                  |.:.:|..    .|.:|                 ..|.|:..|..|.:|         .
  Rat    97 NEPRKREKKTLVLR----DRNLTGLAEDKTPPPSTVNNPGGCNDPQTSPEMKPHSYLDAIRTGLD 157

  Fly    83 DFQATEGV---QDICPY--GGSCIWGSKCSYPLHMEICKMCDLYCLHPMDQNQRRAHNRECLEQH 142
            |.:|:...   |.:|||  .|.|.:|..|.| ||.::|::|.|..|||.|..||:||.:.|:...
  Rat   158 DLEASSSYSNEQQLCPYAAAGECRFGDACVY-LHGDMCEICRLQVLHPFDPEQRKAHEKMCMSTF 221

  Fly   143 EQAMELSFAIARSKDKMCGICFDTVVEK-KGRERRFGILSKCKHIFCLTCIRTWRQAHQFEATVT 206
            |..||.:||...|:||:|.||.:.::|| ...||||||||.|.|.:||:|||.||.|.|||..:.
  Rat   222 EHEMEKAFAFQASQDKVCSICMEVILEKASASERRFGILSNCSHTYCLSCIRQWRCAKQFENPII 286

  Fly   207 RGCPECRVFSEFVCPSAYWVDTKEEKDKLLSEYRAAMGAKDCKYFNGGLGKCPFGNKCFYRH 268
            :.||||||.||||.||.|||:.:.:|::|:..::..||.|.||||..|.|.||||:||.|||
  Rat   287 KSCPECRVISEFVIPSVYWVEDQNKKNELIEAFKQGMGKKACKYFEQGKGTCPFGSKCLYRH 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5347NP_572970.1 ZnF_C3H1 4..30 CDD:214632 9/24 (38%)
PHA03096 <80..239 CDD:222981 77/173 (45%)
RING 159..213 CDD:238093 29/54 (54%)
Mkrn2NP_001008315.1 zf-CCCH_4 6..27 CDD:407881
zf_CCCH_4 37..55 CDD:408151 6/17 (35%)
PHA03096 <179..328 CDD:222981 72/149 (48%)
RING-HC_MKRN2 236..293 CDD:319645 31/56 (55%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 85 1.000 Domainoid score I7980
eggNOG 1 0.900 - - E1_KOG1039
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 254 1.000 Inparanoid score I3107
OMA 1 1.010 - - QHG58455
OrthoDB 1 1.010 - - D1388677at2759
OrthoFinder 1 1.000 - - FOG0000752
OrthoInspector 1 1.000 - - mtm9084
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11224
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X837
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.940

Return to query results.
Submit another query.